SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017884 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017884
Domain Number 1 Region: 21-114
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.11e-31
Family MHC antigen-recognition domain 0.0000302
Further Details:      
 
Domain Number 2 Region: 113-209
Classification Level Classification E-value
Superfamily Immunoglobulin 2.83e-24
Family C1 set domains (antibody constant domain-like) 0.0000411
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017884   Gene: ENSMODG00000014310   Transcript: ENSMODT00000018213
Sequence length 263
Comment pep:novel chromosome:BROADO5:2:270409294:270413828:-1 gene:ENSMODG00000014310 transcript:ENSMODT00000018213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLLPLLMGLGLGFSGAAEGFVTHVESSCVLDEDGSAKDFSYCISFNKAMLTCWDSETK
MMVTVNFGILQGIAEQITNYTNHQSNFISRLSNGLQDCASHTKPFWGALTQRTRLPSVQI
AQVKPFNTRESVMLACYVWGFYPADVAISWLKNGQLIPQSGIQRAVQSNGDWTYQTRSYL
ALTPSTGDIYSCLVEHSGTSQAILQTWTPGLSPKQTLKISVSVFTLCFGLIIFFLGLVSC
RKAGSSDYTVLLGSNYPEGRNIS
Download sequence
Identical sequences F6W4C3
ENSMODP00000017884 ENSMODP00000017884 XP_007483721.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]