SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017888 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017888
Domain Number 1 Region: 86-189
Classification Level Classification E-value
Superfamily Immunoglobulin 9e-24
Family I set domains 0.0000386
Further Details:      
 
Domain Number 2 Region: 390-586
Classification Level Classification E-value
Superfamily Fibronectin type III 1.18e-23
Family Fibronectin type III 0.00000532
Further Details:      
 
Domain Number 3 Region: 293-393
Classification Level Classification E-value
Superfamily Immunoglobulin 1.41e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 4 Region: 184-294
Classification Level Classification E-value
Superfamily Immunoglobulin 4.41e-18
Family I set domains 0.0098
Further Details:      
 
Domain Number 5 Region: 2-95
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000168
Family I set domains 0.0000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017888   Gene: ENSMODG00000014314   Transcript: ENSMODT00000018217
Sequence length 1010
Comment pep:novel chromosome:BROADO5:4:239161791:239249717:-1 gene:ENSMODG00000014314 transcript:ENSMODT00000018217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRG
IKKSDEGTYRCEGRILARGEINFKDIQVIVNVPPTVQARQSTVNATANLGQSVLLMCEAK
GFPEPTMSWTKDGEQIEIEEDDKYSFNEDSSELTIKSVDKNDEAEYVCIAENKAGEQDAS
IQLKVFAKPKINYVENKTAMELEEQITLTCEASGDPIPSITWRTSTRNISNEEKASWTRP
EKQETLDGHIVVSSHVRVSSLTLKSIQYTDAGEYICTASNTIGQDSQAMYLEVQYAPKLQ
GPVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNSPSASYLEVTPD
SENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDEVEPYSSTAQVQFDEPEATGGVP
ILKYKAEWRAMDEEMWHFKWYDAKEANVEGIITIMGLKPETTYAVRLSALNGKGLGEISA
VSEFKTQPVHTPPSREPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRAKLSS
EWKPEIKLPSGSDHVMLKALEWNAEYEVFVVAENQQGKSKAAHFVFRTSAQPTAIPANGS
PTTSLGTGAIVGILIVIFVLLLVAVDITCYFLNKCGLLMCIAVNLCGKAGPGAKGKDMEE
GKAAFSKDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPELPADTTATVEDMLPS
VTTVTTNSDTITETFATAQNSPTSETTTLTSSIAPPATAIPDSNSVPAGQATPSKGPVVP
ASSPPPASAPKVAPLVDLSDTPTSTPAASNLSSSVMATQGAVLSPSAPTNVVEASKTPPG
NKPVPTPTPTNSTSPLAAVSEPPQAKQEPAVTKGPDPEPAPPSTVKSPTEAATALTSPKS
EAASVNTAKPSQGEDFKMDEGTFKTPEIDLAKDVFAALGSAAPAPAASGQAPELASSPAD
SSVSPAPTKTEKTPVEGKSAPQETETQPAPAEVKTVPNEATQTNGNESKA
Download sequence
Identical sequences F6W488
ENSMODP00000017888 ENSMODP00000017888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]