SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017908 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017908
Domain Number 1 Region: 23-206
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 4.79e-76
Family MHC antigen-recognition domain 0.000000449
Further Details:      
 
Domain Number 2 Region: 210-291
Classification Level Classification E-value
Superfamily Immunoglobulin 1.34e-27
Family C1 set domains (antibody constant domain-like) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017908   Gene: ENSMODG00000014450   Transcript: ENSMODT00000018238
Sequence length 352
Comment pep:known chromosome:BROADO5:2:270106252:270110736:-1 gene:ENSMODG00000014450 transcript:ENSMODT00000018238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPSLLSLFVLGVVALTETRAGSHSMRYFYTSMSRPELGDSQFISVGYVDDQQFVRFDSS
SESQRAEPRAAWMDQMDEEDRNYWEGQTQINRRTAQITRVDLETALGYYNQSRGGLHTIQ
RMYGCEVHPDGSFRKGFYQLAYDGRDYIALHRETLTWTAADPGAENTKRKWEAERSFAER
VKAYLEETCVQWVKKYLQMGEDVLLRTDPPSARVSLRCRAQGFYPAEISLTWLRDGEEQL
QDTEFIETRPGGDGTFQKWAAVAMAPGQEDRYSCRVQHEALAQPLSLRWEPEAPSVWVIV
GVTAGVLVLVTAVVAGAVILRRRNSGGKGGAYVPAADKDSAQGSDVSLTVTA
Download sequence
Identical sequences F6V4Y4
ENSMODP00000017908 ENSMODP00000017908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]