SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017976 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017976
Domain Number 1 Region: 240-314
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000078
Family I set domains 0.026
Further Details:      
 
Domain Number 2 Region: 155-240
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000836
Family I set domains 0.0095
Further Details:      
 
Domain Number 3 Region: 38-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000018
Family V set domains (antibody variable domain-like) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017976   Gene: ENSMODG00000021377   Transcript: ENSMODT00000018307
Sequence length 324
Comment pep:novel chromosome:BROADO5:Un:70279302:70291271:-1 gene:ENSMODG00000021377 transcript:ENSMODT00000018307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPSKASQSRGSSWKGLLIITASILSCWIQPTSAQDITVEVEPPLGTQGLSVTFHIVGY
SGTPVMYNWYYKTSAQQPSRKHIVTYSTYNRRQLQTNIRQRVYHNGSMFFPNLLVNDSGY
YEVQIIKDRWTLDRPEAGAPLKVYVGLSKPNIVTSNNTAVENNDFTLTCNATGYLPSTTW
YINQRVQHGTGRIRLSPDNKTLTLPKITRSENKGPYMCEMVNIVSHVNSDGFILDVAYGP
DSMTILPAADRYNVGEHIQLTCSAQSCNPPAQLTWLQNGQLVSNSGTFSATAALNHAGNY
TCVAYNSLTGIRHSQSMNIIIYGE
Download sequence
Identical sequences H9H6P4
XP_016282348.1.35504 ENSMODP00000017976 ENSMODP00000017976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]