SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018011 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018011
Domain Number 1 Region: 4-58
Classification Level Classification E-value
Superfamily Virus ectodomain 4.73e-18
Family Virus ectodomain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018011   Gene: ENSMODG00000014409   Transcript: ENSMODT00000018343
Sequence length 132
Comment pep:novel chromosome:BROADO5:8:24049112:24049507:1 gene:ENSMODG00000014409 transcript:ENSMODT00000018343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAMGLEDLQESLDSLANVVMDNRIALDYLLAAEGGVCMVQNTSCYIYINNSHKVEVPVQE
LHEVSTWMGDAHRKLFPGSSSWKSWLYALLSPFIPIILIIGDILICGPCICNRVISLVAS
RVKAFMGVTEMS
Download sequence
Identical sequences F7C1V3
ENSMODP00000018011 ENSMODP00000018011 13616.ENSMODP00000018011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]