SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018157 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018157
Domain Number 1 Region: 20-119
Classification Level Classification E-value
Superfamily Immunoglobulin 1.15e-42
Family V set domains (antibody variable domain-like) 0.0000336
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018157   Gene: ENSMODG00000023887   Transcript: ENSMODT00000018489
Sequence length 119
Comment pep:known chromosome:BROADO5:1:298771252:298771689:-1 gene:ENSMODG00000023887 transcript:ENSMODT00000018489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFRLNWFFFLITLQGVDSEVQLVETGGDVRQPGGSLRLTCTTSGFTFSNYYMHWIRQAP
GKGLEWVAVIRNPANGLTAEYAEAVKGRFTISRDDASKMVYLQMNSLKTEDTAIYYCAK
Download sequence
Identical sequences A0A0B4J1D9
ENSMODP00000018157 13616.ENSMODP00000018157 ENSMODP00000018157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]