SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018171 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018171
Domain Number 1 Region: 20-122
Classification Level Classification E-value
Superfamily Immunoglobulin 8.97e-48
Family V set domains (antibody variable domain-like) 0.0000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018171   Gene: ENSMODG00000014545   Transcript: ENSMODT00000018503
Sequence length 138
Comment pep:known chromosome:BROADO5:1:298598964:298599900:-1 gene:ENSMODG00000014545 transcript:ENSMODT00000018503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFGLNGIFILMILQGVHCDIQLVESGGDVRQPGGSLKLSCKASGFTFSSYDMSWVRQAP
GKGLEWVSYISSGGSSTNYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCARDTV
RESSERADKNLLSREFWW
Download sequence
Identical sequences F7E8Z5
ENSMODP00000018171 ENSMODP00000018171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]