SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018196 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018196
Domain Number 1 Region: 20-121
Classification Level Classification E-value
Superfamily Immunoglobulin 1.06e-45
Family V set domains (antibody variable domain-like) 0.000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018196   Gene: ENSMODG00000023890   Transcript: ENSMODT00000018528
Sequence length 139
Comment pep:novel chromosome:BROADO5:1:298417211:298417782:-1 gene:ENSMODG00000023890 transcript:ENSMODT00000018528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFGLNGIFILMILQGVHCDIQLVESGGDVRQPGGSLKLSCKASGFTFSSYSMNWVRQAP
GKGLEWVSRIDTGSGTYYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCSRDTVR
ERSERADKNLLIREFWWRM
Download sequence
Identical sequences F7DQ70
ENSMODP00000018196 ENSMODP00000018196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]