SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018222 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018222
Domain Number 1 Region: 20-120
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-45
Family V set domains (antibody variable domain-like) 0.0000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018222   Gene: ENSMODG00000014588   Transcript: ENSMODT00000018554
Sequence length 138
Comment pep:novel chromosome:BROADO5:1:298111355:298112614:-1 gene:ENSMODG00000014588 transcript:ENSMODT00000018554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFGLNGIFILMILQGVHCDIQLVESGGDVRQPGGSLKLSCKASGFTFSSYSMNWVRQAP
GKGLEWVSRIDTGSGTYYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCAGDTVR
ERSERADKNLLSASSVGE
Download sequence
Identical sequences F7A4V4
ENSMODP00000018222 ENSMODP00000018222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]