SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018225 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018225
Domain Number 1 Region: 20-121
Classification Level Classification E-value
Superfamily Immunoglobulin 1.15e-47
Family V set domains (antibody variable domain-like) 0.0000345
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018225   Gene: ENSMODG00000014592   Transcript: ENSMODT00000018557
Sequence length 139
Comment pep:novel chromosome:BROADO5:1:298046745:298047488:-1 gene:ENSMODG00000014592 transcript:ENSMODT00000018557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFGLNGIFILMILQGVHCDIQLVESGGDVRQPGGSLKISCKASGFTFSDYSMNWVRQAP
GKGLEWVSYISYDGSSTGYADSVKGRFTISRDNGNSLLHLQMNSLKTEDTAMYYCARDTV
RERSERADKNHLSESSGGE
Download sequence
Identical sequences F7A4S3
ENSMODP00000018225 ENSMODP00000018225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]