SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018240 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018240
Domain Number 1 Region: 20-121
Classification Level Classification E-value
Superfamily Immunoglobulin 1.2e-47
Family V set domains (antibody variable domain-like) 0.0000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018240   Gene: ENSMODG00000014602   Transcript: ENSMODT00000018572
Sequence length 139
Comment pep:known chromosome:BROADO5:1:297946596:297947253:-1 gene:ENSMODG00000014602 transcript:ENSMODT00000018572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFGLNGIFILMILQGVHCDIQLVESGGDVRQPGGSLKLSCKASGFTFSNYWMSWIRQAP
GKGLEWVSSINNGGSSAYYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTATYYCARDTV
RERSEKADINLFLQSSVGE
Download sequence
Identical sequences F6ZER7
ENSMODP00000018240 ENSMODP00000018240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]