SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018260 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018260
Domain Number 1 Region: 343-440
Classification Level Classification E-value
Superfamily Immunoglobulin 1.57e-27
Family C1 set domains (antibody constant domain-like) 0.00052
Further Details:      
 
Domain Number 2 Region: 127-224
Classification Level Classification E-value
Superfamily Immunoglobulin 2.05e-22
Family C1 set domains (antibody constant domain-like) 0.0026
Further Details:      
 
Domain Number 3 Region: 240-336
Classification Level Classification E-value
Superfamily Immunoglobulin 1.44e-20
Family C1 set domains (antibody constant domain-like) 0.0041
Further Details:      
 
Domain Number 4 Region: 23-120
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-18
Family C1 set domains (antibody constant domain-like) 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018260   Gene: ENSMODG00000014614   Transcript: ENSMODT00000018593
Sequence length 489
Comment pep:novel chromosome:BROADO5:1:297642011:297661583:-1 gene:ENSMODG00000014614 transcript:ENSMODT00000018593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGMKSHLQGTTVTVSSALPSAPNLFSLSPCLNSGVEDAPVAVGCLAKDFLPDSINFSW
TYQNQSAVSHTDLKIFPSQMSGPTYTATSQVILPALDVLQDSYLVCKASHLNSNKQVQVS
LPDTTSSSPNVTVYIPPRDAFSNSGLRKSKLICQVTDFRPREIKLTWLREGRPVSSGFST
GQVLPDGSGTYFLQSSLTINESDWLSQSTFTCRVDHLNAQFQKNVSSSCAISTDSPIEAF
AIPPSFASIFVTKSAKLTCVVTNLPTYDSLSISWTRKDGQLLKTKVKVSSSHPNGTFTAE
GEATVCAEEWNSGEAFKCIVTHSDHPVPLKKEIFKPQEVDLHAPSVYLLPPNPEELSLRE
SATVTCMMKDFSPPDVFVQWMHKGQPIPSEKYVTSSPHQDPQKGGRYFSYSILTVSEAQW
NSGDPFTCVVAHEALPLSSTERTVDKSTEGEVNAEEEGFENLWTTASTFIVLFLLSLFYS
TTVTLFKVK
Download sequence
Identical sequences F6ZDI2
ENSMODP00000018260 ENSMODP00000018260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]