SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018273 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018273
Domain Number 1 Region: 309-408
Classification Level Classification E-value
Superfamily Immunoglobulin 1.72e-23
Family C1 set domains (antibody constant domain-like) 0.00036
Further Details:      
 
Domain Number 2 Region: 97-189
Classification Level Classification E-value
Superfamily Immunoglobulin 1.31e-22
Family C1 set domains (antibody constant domain-like) 0.00081
Further Details:      
 
Domain Number 3 Region: 206-303
Classification Level Classification E-value
Superfamily Immunoglobulin 2.43e-21
Family C1 set domains (antibody constant domain-like) 0.00016
Further Details:      
 
Domain Number 4 Region: 2-97
Classification Level Classification E-value
Superfamily Immunoglobulin 2.15e-17
Family C1 set domains (antibody constant domain-like) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018273   Gene: ENSMODG00000014626   Transcript: ENSMODT00000018606
Sequence length 417
Comment pep:known chromosome:BROADO5:1:297388025:297391225:-1 gene:ENSMODG00000014626 transcript:ENSMODT00000018606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCCDSNSGGKAFLGCLATGYFPESVTINWNSEVLDEIITNFPATYDPTSGRYTTTSQLT
VSDLSDQEFTCSVDHLPTSTKIKKTLSLPECGPVTIIPPTVKLFHSSCDPRGDAHSTIQL
LCLVSGFSPAKVHVTWLVDGQEAENLFPYTTRPKREGGQTFSLQSEVNITQGQWMSSNTY
TCHVKHNGSIFEDSAQKCSDTDPRGISAYILPPTPQDLFVKKVPTIGCLIVDLASAENVK
VTWSRESGGPVNPSSLVVKEQYNGTFTVTSHLPVNTDDWIEGDTYTCRLESPDMPVPLIR
TISKAPGKRLAPEVYMLPPSPEETGTTRTVTCLIRGFYPSEISVQWLFNNEEDHTGHHTT
TRPQKDHGTDPSFFLYSRMLVNKSIWEKGNLVTCRVVHEALPGSRTLEKSLHYSAGN
Download sequence
Identical sequences F6YPV0
ENSMODP00000018273 ENSMODP00000018273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]