SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018356 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018356
Domain Number 1 Region: 6-123
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.7e-38
Family MHC antigen-recognition domain 0.0000296
Further Details:      
 
Domain Number 2 Region: 138-216
Classification Level Classification E-value
Superfamily Immunoglobulin 1.19e-25
Family C1 set domains (antibody constant domain-like) 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018356   Gene: ENSMODG00000014686   Transcript: ENSMODT00000018689
Sequence length 264
Comment pep:novel chromosome:BROADO5:2:269410741:269417099:-1 gene:ENSMODG00000014686 transcript:ENSMODT00000018689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAVWISTNFWKIGLLMTLMMFCLPVSWARDIPEDFVYQYRALCYFTNGSKQVRLVNRHF
YNDQETVRYDSKLGKHVAVTELGRRDAEYWNSRKDILERKRASLDTVCRHNYEAYKPFTL
ERRAQPRLTVSPSKQEAQQHLLVCSVTGFYPSKIKVTWLKNGQEQTAGVISTGLIQHGDW
TYQTLVMLETIPQSRDIYTCSVEHASLQSPIAVEWRAQSGSAQSKLVSGVGGFVLGLIFL
SVGLILHLKSQKGRAGPQPAGNVP
Download sequence
Identical sequences F7DNM7
ENSMODP00000018356 13616.ENSMODP00000018356 ENSMODP00000018356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]