SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018358 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018358
Domain Number 1 Region: 29-108
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.66e-27
Family MHC antigen-recognition domain 0.0000572
Further Details:      
 
Domain Number 2 Region: 110-208
Classification Level Classification E-value
Superfamily Immunoglobulin 1.12e-24
Family C1 set domains (antibody constant domain-like) 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018358   Gene: ENSMODG00000014687   Transcript: ENSMODT00000018691
Sequence length 251
Comment pep:novel chromosome:BROADO5:2:269387468:269390239:1 gene:ENSMODG00000014687 transcript:ENSMODT00000018691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGRILILETLSLVMLLSPWAASESIEADHVGRYGTTMAQSYGPSGQYTMEFDEDELFY
VDQQKKETVWRLPEFSHFAGFDPQTGLREIATNEHNLDCLIKRSNRTKAIPVAPEVTVFP
ESPVELDQPNVLICLVDNIFPPVVNITWLCNGQVITTGVSGTEFYPRSDYKFRKFYYLTF
LPNTEDVYDCQVEHWGLEQPIFRYWEPQFPSPLPETTETMVCALGLAVGLVGIILGTILI
IKSMCSSSRIQ
Download sequence
Identical sequences F7DNL5
ENSMODP00000018358 ENSMODP00000018358 13616.ENSMODP00000018358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]