SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018386 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018386
Domain Number 1 Region: 82-164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000483
Family I set domains 0.009
Further Details:      
 
Domain Number 2 Region: 174-262
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000454
Family I set domains 0.023
Further Details:      
 
Domain Number 3 Region: 8-86
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000034
Family I set domains 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018386   Gene: ENSMODG00000014708   Transcript: ENSMODT00000018719
Sequence length 271
Comment pep:novel chromosome:BROADO5:Un:58893235:58902273:-1 gene:ENSMODG00000014708 transcript:ENSMODT00000018719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNKDWPVETKDFSMTCQATGQIEAYQWFINGLAPVGSRIQLSRDKRTLTLPRLTRRDNQG
PYVCGIENPLFSSMSDPFTVNVTYGPDNATIVRTPDVYPTGANIIFNCSADSNPPAQFTW
LYKGQQIRNSSIFSIIASVGDAGTYTCTASNSLTGLTRTASKTLRIYAPLSKPTILISNN
TAVETKDFSMTCQATGQIEAYQWFINGLAPVGSRIQLSRDKRILTLPRLTRRDNQGPYVC
GIENPLFSSMSDPFTVNVTYGPDNATIVRTP
Download sequence
Identical sequences H9H6P7
13616.ENSMODP00000018386 ENSMODP00000018386 ENSMODP00000018386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]