SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018394 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018394
Domain Number 1 Region: 27-108
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 6.94e-28
Family MHC antigen-recognition domain 0.0000497
Further Details:      
 
Domain Number 2 Region: 110-208
Classification Level Classification E-value
Superfamily Immunoglobulin 4.01e-26
Family C1 set domains (antibody constant domain-like) 0.0000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018394   Gene: ENSMODG00000014713   Transcript: ENSMODT00000018727
Sequence length 256
Comment pep:novel chromosome:BROADO5:2:269169718:269174490:1 gene:ENSMODG00000014713 transcript:ENSMODT00000018727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSRVLILGTLSLVMLLSPWAASEFIKADHVGTYGTTMAQSYGPSGQYTMECDEDEIFY
VDQQKKETVWRLPEFSHFAGYDPQGGLRNIDVMEHNLDILIKRSNRTRAIPVAPEVTVFS
ESPVELDQPNVLICLVDNIFPPVVNITWLRNGQIITTGVSGTEFYPRSDHRFQKFYYLTF
LPNTEDVYDCQVEHWGLEQPVLRHWEPQFPSPLPETTETVVCALGLAVGLVGIILGTILI
IKSMRSSSRIQLQGPL
Download sequence
Identical sequences F7D2Z8
ENSMODP00000018394 XP_001376764.1.35504 ENSMODP00000018394 13616.ENSMODP00000018394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]