SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018405 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018405
Domain Number 1 Region: 28-110
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 4.03e-29
Family MHC antigen-recognition domain 0.0000285
Further Details:      
 
Domain Number 2 Region: 111-206
Classification Level Classification E-value
Superfamily Immunoglobulin 1.32e-23
Family C1 set domains (antibody constant domain-like) 0.0000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018405   Gene: ENSMODG00000014722   Transcript: ENSMODT00000018738
Sequence length 257
Comment pep:novel chromosome:BROADO5:2:269111369:269119144:1 gene:ENSMODG00000014722 transcript:ENSMODT00000018738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAPNKAWILGALTLAALLSPWGAKAIQENHVIIQAEFAQTSNPEGEFMFDFDGDEIFHV
DMDKRETVWRLTDFSNFASFEAQGALANLAVDKANLEIMMKRSNNTPDTNVPPEVTVFPK
GPVELGHPNVLVCFIDKFSPPVLNVTWLQNGKPITDGVFETVFLPRADHSFRKFHYLTFI
PSATDFYDCEVDHWGLEQPTIKHWEPEVRTPLPETTETVVCALGLAVGLVGIIAGTILFI
KAKRSSNTSRGGPRGPL
Download sequence
Identical sequences F6ZD60
XP_007483702.1.35504 ENSMODP00000018405 ENSMODP00000018405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]