SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018466 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018466
Domain Number 1 Region: 320-479
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-58
Family SPRY domain 0.0000283
Further Details:      
 
Domain Number 2 Region: 15-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000157
Family V set domains (antibody variable domain-like) 0.0086
Further Details:      
 
Domain Number 3 Region: 138-213
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000167
Family C1 set domains (antibody constant domain-like) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018466   Gene: ENSMODG00000014767   Transcript: ENSMODT00000018799
Sequence length 480
Comment pep:novel chromosome:BROADO5:2:268842891:268853391:-1 gene:ENSMODG00000014767 transcript:ENSMODT00000018799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFVLCFLFHQTDKLKVTGSIHPTVAKRGEDVTLSCHLSPETYAKHMKVRWFQVHFFHPGH
MDVDMNRKPIAEDKRISTEPDAINKGIVTLKIFHVDTSDNGQYWCRFEQNGLFQEASLEL
KVAGLGSSPQIYLKGNKDGRLQLVCTSEGWFPQPLMWWRVEGGENLSSLSEDRIQDINGL
FHVETSVMIRNDSMGDVICSIYNPLLGQELSASYIPESPLLGMIPSWKTLLLTLGLFLIV
TIGGFIWHPGHKKGKNFFFLNKKTTELSSQSSQDDKDHKSLQAEIDYSLQNKDLQLISNP
ECCLSVSSWSKWEKFKPAALVNCILDSKTAHPELIISEKGRYMTRGNMRQNLPDNPQRFN
FLPSVLGQKKITSGKHYWEVEVGPGSGWFLGICREDVNRKRDTQVTPENGFWIIGSYGND
YWAITSPSTLLSLRVSPHKICVSLDYHRGQLSFKNVTDGSHIHTFHITSFSGTLRPFFLL
Download sequence
Identical sequences F7GGR9
ENSMODP00000018466 ENSMODP00000018466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]