SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018554 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018554
Domain Number 1 Region: 31-143
Classification Level Classification E-value
Superfamily Immunoglobulin 5.54e-21
Family V set domains (antibody variable domain-like) 0.00019
Further Details:      
 
Domain Number 2 Region: 157-268
Classification Level Classification E-value
Superfamily Immunoglobulin 8.94e-21
Family V set domains (antibody variable domain-like) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018554   Gene: ENSMODG00000014831   Transcript: ENSMODT00000018887
Sequence length 273
Comment pep:novel chromosome:BROADO5:2:268578533:268617728:1 gene:ENSMODG00000014831 transcript:ENSMODT00000018887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDVTSWTVLTVSVAIVSLFGILIMRPSEKFTVTGSAEPILAKLNEDVILPCHLSPKMSA
EHMEVVWFRSQFSDAVYVYRNGKAQDGEQAMEYKGRTELVKDTIAEGYVALRIRSVRLSD
NGQYWCRFQENNEYGEARSEVIVTTSVSTFSTAMRKVIGLTQSIITRVGEDVLLPCHLFP
EMNAQNMEVGWIRSQFSDIVYMYRDGKDQEEEQMVKFKGRTVFIKDAITNGNVALKIRNI
RVSDGGQYQCYFEKNQVFQRAVLEIQVQGKVLN
Download sequence
Identical sequences F7CHW1
ENSMODP00000018554 ENSMODP00000018554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]