SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018565 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018565
Domain Number 1 Region: 42-206
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 6.46e-70
Family MHC antigen-recognition domain 0.00000139
Further Details:      
 
Domain Number 2 Region: 211-301
Classification Level Classification E-value
Superfamily Immunoglobulin 2.72e-29
Family C1 set domains (antibody constant domain-like) 0.0000763
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018565   Gene: ENSMODG00000014839   Transcript: ENSMODT00000018898
Sequence length 364
Comment pep:novel chromosome:BROADO5:2:268510012:268513216:-1 gene:ENSMODG00000014839 transcript:ENSMODT00000018898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGAMKPSLPSLFVLGVVALTETRAGEEGSVFFHCHGPGPEVRDSQFISVGYVDDQQFVRF
DSSSESQRLELRAAWMDKVDEDYWERQTQISRRTAQIYGVNLETLLGYYNQSRGGLHTLQ
RMLGCEVHPDGSFRKGFDQHAYDGHDYIALDRETLTWTAADTGAENTKRKWEAERSFAEG
QKAYLEETCVQWLKKYLQMGKDVLLRTDPPSARVSRHSGPDGEVSLRCRAQGFYPAEISL
TWLRDGEEQLQDTEFIETRPGGDGTFQKWAAVAMAPGQEDRYSCRVQHEALAQPLSLRWE
PEASSLWVIAGVTAGVLVMVTAVVAGAVILRRRNSGGKGGAYVPAADKDSAQGSDVSLTV
TGEA
Download sequence
Identical sequences F7CHG1
ENSMODP00000018565 13616.ENSMODP00000018565 ENSMODP00000018565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]