SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018610 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018610
Domain Number 1 Region: 256-323
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000207
Family I set domains 0.017
Further Details:      
 
Domain Number 2 Region: 19-115
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000848
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 158-224
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000173
Family C2 set domains 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018610   Gene: ENSMODG00000014881   Transcript: ENSMODT00000018945
Sequence length 422
Comment pep:novel chromosome:BROADO5:2:268413240:268416146:-1 gene:ENSMODG00000014881 transcript:ENSMODT00000018945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLTSSGAWLLILSLGVVGSQNISSRIGEPLVLNCKGAPRKPPQQLEWKLNTRRTEAWK
VLSPEGDPWESVARVLPNGSLLLPAVGIQDEGTFRCRATNRHGKEIKSNYRLRVYQIPGK
PEIVEPASELIAGIPNKVGKLMREPRRGIVTLVYQVGTCLSEGGYPAGTLSWHLDGKSLV
PDGKGVSVREETRRHPDTGLFTIQSELTVTPVPGGPLNPTFSCSLSLGPRSSGQRTLHTA
PIQLSVWEPEPLEEVRLVVEPEGGAVAPGGAITLTCEAPAQPPPQIHWLKDGSPLAIAPR
SVLFLPEVGVQDQGIYSCVATDQSHGSRESPGVSVSIIETGENGQEEGSVGGPRLGLLAL
VLGVLGGLVTAVLLVGILLWKRQHRLRKEERKVPECPEEEEERAELHQSEEQETAESNAG
GP
Download sequence
Identical sequences F7GGK6
ENSMODP00000018610 ENSMODP00000018610 13616.ENSMODP00000018610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]