SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018631 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018631
Domain Number 1 Region: 1-182
Classification Level Classification E-value
Superfamily EF-hand 9.95e-32
Family Calmodulin-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018631   Gene: ENSMODG00000014899   Transcript: ENSMODT00000018967
Sequence length 215
Comment pep:novel chromosome:BROADO5:3:479375489:479394441:-1 gene:ENSMODG00000014899 transcript:ENSMODT00000018967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNKQTVFTPEQLDAYQDCTFFTRKEILKLFYRFQDLAPQLVPFDYTGKPDVKLPYEVIC
GMPELKDNPFRERIAQVFSQDGDGNMTLDDFLDMFSVMSEMAPRDLKAYYAFKIYDFNND
DYICPLDLEKTVTKLTRGELTPEEVGLVCEKVINEADVDNDGKLSLDDFQNMILHAPDFL
RLCASTMKNAVDTDKNSTVCPQRILQSISTFHIRI
Download sequence
Identical sequences F7G6I4
XP_007489784.1.35504 XP_007489785.1.35504 XP_007489786.1.35504 XP_007489787.1.35504 XP_016287841.1.35504 XP_016287843.1.35504 ENSMODP00000018631 ENSMODP00000018631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]