SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018678 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018678
Domain Number 1 Region: 3873-4091
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.57e-76
Family Fibrinogen C-terminal domain-like 0.00000207
Further Details:      
 
Domain Number 2 Region: 3699-3872
Classification Level Classification E-value
Superfamily Fibronectin type III 8.88e-21
Family Fibronectin type III 0.0000427
Further Details:      
 
Domain Number 3 Region: 3611-3699
Classification Level Classification E-value
Superfamily Fibronectin type III 6.35e-19
Family Fibronectin type III 0.0000943
Further Details:      
 
Domain Number 4 Region: 2330-2414
Classification Level Classification E-value
Superfamily Fibronectin type III 3.08e-17
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 5 Region: 1120-1207
Classification Level Classification E-value
Superfamily Fibronectin type III 6.75e-17
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 6 Region: 1456-1540
Classification Level Classification E-value
Superfamily Fibronectin type III 7.55e-17
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 7 Region: 715-882
Classification Level Classification E-value
Superfamily Fibronectin type III 8.2e-17
Family Fibronectin type III 0.00091
Further Details:      
 
Domain Number 8 Region: 1553-1731
Classification Level Classification E-value
Superfamily Fibronectin type III 2.09e-16
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 9 Region: 3208-3298
Classification Level Classification E-value
Superfamily Fibronectin type III 3.97e-16
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 10 Region: 1327-1412
Classification Level Classification E-value
Superfamily Fibronectin type III 4.48e-16
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 11 Region: 1759-1843
Classification Level Classification E-value
Superfamily Fibronectin type III 5.35e-16
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 12 Region: 2780-2863
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000144
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 13 Region: 2669-2752
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000195
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 14 Region: 2890-2973
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000216
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 15 Region: 2213-2297
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000023
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 16 Region: 2539-2623
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000041
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 17 Region: 3016-3100
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000443
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 18 Region: 2087-2170
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000547
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 19 Region: 1227-1314
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000747
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 20 Region: 3515-3607
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000086
Family Fibronectin type III 0.0000109
Further Details:      
 
Domain Number 21 Region: 3309-3391
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000195
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 22 Region: 1871-1954
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000197
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 23 Region: 3419-3501
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000227
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 24 Region: 1976-2059
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000235
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 25 Region: 3121-3205
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000664
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 26 Region: 1022-1109
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000014
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 27 Region: 2429-2512
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000315
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 28 Region: 922-1013
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000889
Family Fibronectin type III 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000018678
Domain Number - Region: 368-392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00502
Family Integrin beta EGF-like domains 0.041
Further Details:      
 
Domain Number - Region: 338-362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0067
Family Integrin beta EGF-like domains 0.041
Further Details:      
 
Domain Number - Region: 245-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00698
Family Integrin beta EGF-like domains 0.07
Further Details:      
 
Domain Number - Region: 493-517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00865
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number - Region: 183-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0112
Family EGF-type module 0.059
Further Details:      
 
Domain Number - Region: 276-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0114
Family Integrin beta EGF-like domains 0.055
Further Details:      
 
Domain Number - Region: 586-610
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0128
Family Integrin beta EGF-like domains 0.084
Further Details:      
 
Domain Number - Region: 400-424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0165
Family Integrin beta EGF-like domains 0.055
Further Details:      
 
Domain Number - Region: 462-485
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0232
Family Integrin beta EGF-like domains 0.034
Further Details:      
 
Domain Number - Region: 431-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0237
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 555-579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 214-238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0474
Family Integrin beta EGF-like domains 0.081
Further Details:      
 
Domain Number - Region: 307-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.067
Family Integrin beta EGF-like domains 0.064
Further Details:      
 
Domain Number - Region: 684-707
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0725
Family Integrin beta EGF-like domains 0.066
Further Details:      
 
Domain Number - Region: 524-548
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0977
Family Integrin beta EGF-like domains 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018678   Gene: ENSMODG00000014936   Transcript: ENSMODT00000019015
Sequence length 4100
Comment pep:novel chromosome:BROADO5:2:268243811:268317920:-1 gene:ENSMODG00000014936 transcript:ENSMODT00000019015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISTRDPLGPSLVLLVLLGVAGAGPFPPRSNETASTPRLPPHPGGRTAGPGGGGSSSKLY
EHTVDGGEKQVVFTHRINLPSSANCGCPPGAEPPAPASEVQALRVKLEALEELVKGLKEQ
CQGGCCPAAAQAGTGQTDVRSLCSRHGVFDLGRCACSCEPGWAGPTCSDPISSSSTSSCP
DDCNDQGRCVEGRCVCFPGYTGPSCGWPACPRDCRGRGRCVQGVCVCRAGFTGEDCGTRA
CPKDCSQRGLCKDGKCVCDPGYSGEDCGTRSCPRGCNQRGRCEDGRCVCDPGYSGEDCGT
RSCPRDCGDGGRCVGGRCVCWPGYSGEDCSVRTCPRDCHGRGRCEDGECICEAGYSGDDC
GVRSCPQNCNQRGYCEEGRCVCWPGYTGDDCGSRACPLDCRGRGRCENGACVCNAGYSGA
DCGVRTCPGDCLGRGRCENGRCVCWPGYTGKDCGTRACPGDCRGRGRCQDGRCVCEPGYA
GDDCGSRRCPADCRGRGRCEDGVCVCDRDYTGEDCSQRRCPGDCRGQGQCQEGICACDTG
YTGEDCGIRSCLRDCSHQGVCHDGVCACWEGYTGDDCSLRTCPGNCNRRGRCENGRCVCA
TGYTGPACGTRTCPRDCWGRGRCIQGVCVCQEGYSGEDCGQEEPLAGSCPGGCGPRELCR
AGQCVCVEGFEGPDCATRTCPGDCRGRGKCQEGSCICKDGYAGEDCGEEISPITGMRMHL
LEETTVRTEWTPASGPVDTYEIRFIPTTEGTGRPFSARIPSSASTYDQRGLSPGQEYQVT
VRPLRGSSWGPPTSQTITTMIDGPQDLRVTAVTPTTMELSWLRPQAEVDRFVVSYVSAGN
KRVRLDVAPEEDRTLLTGLMPGVEYVVTVTAERGHAVSYPASVRANTGTIWPSPFGATDE
PPVLELSPSPTTQGVQAPIMTRPGELVEFKVIHTDRAGQLPIRWTAPRGHFNEFLLRVEP
FHGWGGTPQEVAVPGDQRAARLSGLWPHTPYTVILYGVRGGLLSPPLRANLTTVNKTGTH
FVPPRLGELQALVVSSNFIKLYWTVPEGQFDSFLIQYKDKSGKLQVVTVEGFQHSVPISS
LDPGHKYKFILYGLTGKKHHGPLTVEAKTWIQENPQKLRIPPRLGELWVTDPTSNSLHLS
WTVPEGQFDSFLVQYKDKDGQIQMVPVEGPERSITVSQLDPNRKYKFILYGLVGKKRHGP
LSADGTTATQWEEPPRTTESPKPRLGELTVTEVTQNSLRLLWTILEGKFDSFVVQYKDKD
GQSQVVPVEVGQNEVTISDLQPSRKYKMNLYGLQGKQRVGPISVIATTAPPEEETPVPTS
PATDELPRLEELMVTDATSDSLHLSWTVPEGQFESFMIQYKNGDGQPKVVRVKGDKNMVI
ISGLEPDHKYKLNLYGFHDGQRVGPISITGVTGEDNTIPKLVVMCLVISALHEGVKEIPA
PTVPATEAPEPTDKPQLGELTVTGATQDSLQLSWTIPQGGFDSFTIQYKDKDGRPQIVRV
GGDQNEVTVSDLEPDHRYKMNLYGYHDGQRVGPVSVTGVTGENEETTPTSTEPPPNPRLG
ELKVTDATSDSLNLSWTVPEGQFDSFIIQFKNRDGQPRAVHVEGHKDTVIISGLEPSHVY
KMNLYGFHDRQRVGPISTIGVTASAPMVPVTEAPEPTEKPQLGELTVMGVTQDSLQLSWT
ISQGDFDSFTIQYKDKNGRPQAMRVGGDQNEVTISGLEPDHRYKMNLYGYHDGQRVGPVS
VIGLTEPATEAPEPTEKPQLGELTVTGATQDSLQLSWTISQGDFDSFTIQYKDKDGRPQA
MRVGGEQNEVTVSDLEPDHKYKINLYGFHNGQRVGPVSVTGKTVPQKVIEETPVPTVPAT
EAPEPTEKPQLGELMVIGATQDSLQLSWTISQGDFDSFTIQYKDRYGQPQIMRVEGDQNE
VTISDLEPNHKYKMNLYGYHDGQRVGPVSVIGKTEETPVPIVPATEAPEPTEKPQLGELM
VTGATQDSLQFSWTISQGDFDSFTIQYKDRYGQSQIMRVGGDQNEVTISDLEPDHKYKMN
LYGFHDGQRVGPVSVIGKTAAHKVEEETPVPTVPTTEAPEPTEKPQLGELMVTGATQDSL
QLSWTISQGDFDSFTIQYKDRYGQPQIMRVEGDQNEVTISDLEPDHRYKMNLYGFHDGQR
VGPVSVIGKTGKIVKGETPVRIYFLPIDPHKVEETPVPTVPATEAPEPTEKPQLGELTVT
GATQDSLQLSWTISQGDFDSFTIQYKDKDGRPQIMRVEGDQNEVIISDLEPDHKYKMNLY
GFHDGQRVGPVSVIGKTGRTEEANSHKVTEETPAPTEPATEAPEPTEKPQLGELTVTGAT
QDSLQLSWTIPQGDFDSFTIQYKDKDGRPQIMRVGGDQNEVTVSDLEPDHKYKVNLYGFH
DGQRVGPVSVIGITVPATEAPEPTEKPQLGELMVIGATQDSLQLSWTISQGDFDSFTIQY
KDRYGQPQIIRVGRDQNEVTISDLESDHKYKMNLYGYHDGQRVGPVSVIGKTAPHKVEEE
TPVPTVPTTEAPEPTEKPQLGELTVTGATQDSLQLSWTISQGDFDSFTIQYKDRYGQPQI
MRVEGDQNEVTISDLEPDHKYKMNLYGFHDSQRVGPVSVIGKTGSLDYILPMKWKNTLEE
HRNPHKVEETPVPTVPATEAPEPTEKPQLGELMVTGASPDSLQLSWTISQGDFDSFTIQY
KDKDGRPQAMRVEGDQNEVTISDLEPDHKYKMNLYGFHDGQRVGPVSVIGKTDPHKVIEE
TPVPTVPATEAPEPTEKPQLGELMVTGASPDSLQLSWTISQGDFDSFTIQYKDKDGRPQA
MRVGGDQNEVTISDLEPDHKYKMNLYGFHDGQRVGPVSVIGKTDPHKVEETPVPTVPATE
APEPTEKPQLGELMVTGASPDSLQLSWTISQGDFDSFTIQYKDKDGRPQAMRVEGDQNEV
TISDLEPDHKYKMNLYGFHDGQRVGPVSVIGKTGNEKVFPSCPLKYGQDTHPHKVEETPV
PTVPATEAPEPTEKPQLGELTVTGATQDSLQLSWTISQGGFDSFTIQYKDKDGRPQAMRV
EGDQNEVTISDLEPDHKYKMNLYGFHDGQRVGPVSVIGKTETPSPTVLTTEAPTEVSVKP
QLGKLTVMKTTSDSLHLSWTVPEGQFDSFMMQYKNGDGQSKAVRTGGSQKEIIISGLEPN
HKYKMNLFGFFDGQRVGPISTTAVTDTEVPPEPYLGELTVTDVRQDSLHLSWSVLQGPFD
SFVIQYKDREGRPQVLPVAGDQSGVTVSGLEPSRKYKFLLFGLHNGKRSAPTSAEAKTLP
AVKPSPLLGEMIVTDSTPGSLNLSWTILQGPFDSFVVQYKDKDGQLQVVPVGKDQREITI
SNLEPNRKYKFLLYGLFGKKRIGPISADGITAQEEETTTSFIPATEAPEPQPPSGPRLGI
LKVTDVSPDSLSLSWTVLQDSFNSFVIQYKDKDGQSQAELVRGNQKNITISDLEPNRKYT
FLLYGLYDGKRLGPITAEGTTGLPPAKQSIGGRLSQLSVSDVTTSSFRLNWEAPPGAFDS
FLLRYGVPEMRPSEPPSPPLLQREMNVAGIRRSAVLRDLRPGTLYTVTLYGLRGPHKADS
LQGTARTLSPVLESPRDLKFSEIQENSAKVSWSPPPNRVDSFKISYQLADGGEPQSIQVD
SHTWHQRLVGLTPGARYEVTVVSVRGFEESEPLSGFLTTVPDGPTHLQALNVTDDSALLH
WSPPQDPADRYALQVTAPGVPPLRASVPGSAVDFPLNNLQLRTNYTATLRGFRGPNITSP
ASITFSTGLDAPRDLKATEVTPRSALLTWTEPASLPSNYLLSYDTAGGQTQEILLPGGAR
SHRLSGLFPSTLYSARIQAVWGESLTPPVPTTFTTGGLKIPFPRDCGEERQNGLGTSRTT
TIFLNGNRERPLEVYCDMETDGGGWLVFQRRMDGRTDFWRDWAEYAGGFGNISGEFWLGN
EVLHSLTQAGDYSMRVDLRAGNESAFAEYDFFTVDSAARYYRLHLEGYRGTAGDSMGYHS
GSTFSTRDRDPNNLHIPCAVSYRGGWWYRNCHYANLNGLYGSIIDHQGVSWYAWKGFEFS
IPFTEMKLRPRSYRPPSQRA
Download sequence
Identical sequences F7FIQ1
ENSMODP00000018678 13616.ENSMODP00000018678 ENSMODP00000018678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]