SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018681 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018681
Domain Number 1 Region: 32-129
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-26
Family Kringle modules 0.001
Further Details:      
 
Domain Number 2 Region: 217-323
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-24
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018681   Gene: ENSMODG00000014939   Transcript: ENSMODT00000019018
Sequence length 487
Comment pep:novel chromosome:BROADO5:Un:58147646:58160481:-1 gene:ENSMODG00000014939 transcript:ENSMODT00000019018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPHSSRGASAPSPTQISPPGAPLTAAFPGCFFPECFTANGVDYRGRQNWTAPHGGKACLF
WNETFQHPYNTLKYPHGEGGLGDHNYCRNPDGDVSPWCYVAEHEDGVYWKFCEIPACQMP
GNLGCYRDLGNPPPLTGTSKTSNKLTIQNCISFCRSQKFKFAGMESGYACFCGNNPDYWK
YGETASTECNSICFGDHTQPCGGDGRIILFDTLIGACGGNYTAASSVIYSPDFPDNYATG
RACYWTIRVAGAARILFNFTLFDIRDAADMVELLDGYSHRVLARFGGRHRPPPAFNVSLD
FVILYFFSDRVNQAQGFAVLYQALQEEVPAVGPTRNQSLAEGITEQSNLSASAARASKVL
YVITTSPSHPPRAVPGRPSPRPSPSAATRGPGSPQPGPLGWTMYGLASLLILTVKAVLAK
ALLHDDPRVCRRAQRVAAAGELRDCRQARAPGEIWSIFYEPATSVSIFKKKLRGQSQPDD
RNPLVGD
Download sequence
Identical sequences H9H6Q3
ENSMODP00000018681 13616.ENSMODP00000018681 ENSMODP00000018681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]