SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018779 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018779
Domain Number 1 Region: 121-217
Classification Level Classification E-value
Superfamily Immunoglobulin 3.56e-18
Family I set domains 0.0033
Further Details:      
 
Domain Number 2 Region: 31-119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000933
Family I set domains 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018779   Gene: ENSMODG00000015019   Transcript: ENSMODT00000019117
Sequence length 271
Comment pep:novel chromosome:BROADO5:Un:96058580:96060412:1 gene:ENSMODG00000015019 transcript:ENSMODT00000019117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSFWARDVGRPGMGGPSRALGCRSLPDASRRPSLTAEPGLVIPRGQPVSFRCQGPPGTE
LYRLKKEGAEQFMDLPAAEGGGLFSLETAPNTAGNYSCLYKIQTAWSEPSNTLQLVVTGL
YEPPSLSALPGPNVTAGQNVTLRCQTELWFSSAALAKDGETVGFGSALHTGPGSRTDFLL
AAVSDAQQGRYRCYSFHGAASEKWSSPSAPVELRLTGEAGRPSQPPSSPKLPHCPKDLLQ
GVPEARRLEEEEAQRGGMESGPWVNLREWRQ
Download sequence
Identical sequences H9H6R3
ENSMODP00000018779 ENSMODP00000018779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]