SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018951 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018951
Domain Number 1 Region: 2949-3237
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-69
Family Protein kinases, catalytic subunit 0.00000682
Further Details:      
 
Domain Number 2 Region: 1552-1849
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.92e-60
Family Protein kinases, catalytic subunit 0.00000289
Further Details:      
 
Domain Number 3 Region: 679-771
Classification Level Classification E-value
Superfamily Immunoglobulin 9.7e-24
Family I set domains 0.0063
Further Details:      
 
Domain Number 4 Region: 1022-1119
Classification Level Classification E-value
Superfamily Immunoglobulin 5.49e-23
Family I set domains 0.00093
Further Details:      
 
Domain Number 5 Region: 826-919
Classification Level Classification E-value
Superfamily Immunoglobulin 1.71e-22
Family I set domains 0.006
Further Details:      
 
Domain Number 6 Region: 1240-1343,2630-2725
Classification Level Classification E-value
Superfamily Fibronectin type III 7.9e-22
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 7 Region: 1441-1534
Classification Level Classification E-value
Superfamily Immunoglobulin 3.9e-20
Family I set domains 0.0014
Further Details:      
 
Domain Number 8 Region: 2543-2635
Classification Level Classification E-value
Superfamily Immunoglobulin 1.26e-19
Family I set domains 0.0099
Further Details:      
 
Domain Number 9 Region: 1147-1246
Classification Level Classification E-value
Superfamily Immunoglobulin 3.46e-18
Family I set domains 0.02
Further Details:      
 
Domain Number 10 Region: 44-130
Classification Level Classification E-value
Superfamily Immunoglobulin 3.23e-17
Family I set domains 0.0074
Further Details:      
 
Domain Number 11 Region: 930-1018
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000182
Family I set domains 0.012
Further Details:      
 
Domain Number 12 Region: 1348-1446
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000084
Family I set domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018951   Gene: ENSMODG00000015165   Transcript: ENSMODT00000019293
Sequence length 3256
Comment pep:novel chromosome:BROADO5:7:173143095:173226428:-1 gene:ENSMODG00000015165 transcript:ENSMODT00000019293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKARGTRGESVSPRAPPSPGVPPKRAKVGSGAGTGARGTAAGAPVFHRQLKNTAVFSGR
DVRLQVVVSGTPQPVLSWLRDEKPLPQPSPEPSCLWLRGCGAQDAGAYTCIARNERGEAS
TTGVLTVLEVEVFRSCRKQSYDSETGEDDISDAQGTQRLELQEDGAFSTPTGGSDTLVGT
SLDTPPTSVTGTSEEQASWWGSGQTVLEQEAGSSGGGGSSRRLPGSPSSVPQAGLRREDP
DPQPQPASEAPRRPAQPPPSKSALLPPPSPRVGKRPPSVPGTQPPAPSTVPQRKPQEPGA
LEELEEKRGKKPKSSGPSLAGTLESRSQTPLSEASGRLSGVRCSPRLVRAGSRILDKLQF
FEERRRSLEKSDSPVPLRAWVPLRKARSLDQPKAEGGQWGTPGTSREELREGSRGELGTV
AERRWLFRQKAASLDDRVRQRSPSPATDLELRFAQELGRIRRSASREELVRSHESLQATL
QKAPSPRDPGEPPLFSSPSTPKTPPPESTSTVQQLALSSVGRVGDEAAGKGAGAARGRGQ
AGRTDLGEGHQQEVRRREQFPLTRGRAIQESRSPEPPEPRTKAHLGRKRDPPTQAVRFLP
WATPEPEGSAVPPTLEKNQPGPEAEKRLRRGPEEDGPWGAWDRRAPRSKGKGHHRARPTS
PDLESSDDSYVSAGEEPLEAPVFEIPLQSVVVAPGFDAMLKCIVTANPPPQVSWQKDGTP
LQSSERILVRDEGERHTLLLQEARLADSGLYTITATNELGQATCNASLSVEPGGAKSPFS
SPITSDEEYLSPPEEFPEPEEAWHKTSAMKLSPSQAQSTPDTSSRAPPIFKVSLMDQSVR
EGQDVTMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYT
CKAVNEYGTRQCEARLEVRAHPESRSLAVVAPLQDVNVGAGEMALFECLVTGPSDVEVDW
LCRGRLLQPALLKCKMHFDGRKSKLLLTSVHEDDSGVYTCKLSTAKDELTCSARLTVRPS
LAPLFTRILEDVEVLEGRGARFDCKISGLPPPTVTWTHFGNPVEENENVRLRHEGGLHSL
LIAHVGSEDEGLYEVSATNIHGHANCSAQLYVEEPRSSTSGPSSKLEKMPSIPEEPEQGE
LERLSIPDFLRPLMDLEVGLAKEAVLECQVTGLPYPTISWFHNGQRIQSSDDRRMTQYRD
VHRLVFPVVGPQHAGVYKSVIANKLGKAACYAHLYVTDLVPGPPDGPPQVVNVTGRMVML
KWNPPRSVDMAIDPDTLTYTVQHQVVGSGQWTALASGLREPSWAAMGLRKGAQHIFRVLS
TTVKSSSKPSPASEPVQLLERGPVLEEAPVVLDKPDVVYVVEGQPVSVAVTFNHVEAQVV
WRSCRGALLEARAGMYELSQPDDDQYCLRICHVNRRDVGALSCTARNRHGTQACSITLEL
AEAPRFESIMEDVEVGPGETARFAVVVEGKPLPDIMWYKEEALLEESSHLSFVYEESECS
LVVLSTGPQDGGVYTCTARNLAGEVSCKAELAIRTAQTSMEIEGVGEEEELRGQRLSDFY
DIHQEIGRGAFSYLRRVVERSSGLEFAAKFIPSQAKPKASARREAGLLSRLQHDCVIYFH
EAFERRRGLVIVTELCTEELLERMARKPTVCESEIRGYVKQVLEGVSYLHQSHVLHLDIK
PENLLVWDGAGGAEQVRICDFGNAQELTPEEPQYCQYGTPEFVGPEIVNQTPVSGVTDVW
PVGVVAFLCLTGISPFVGENDRTTLMNIRNYNVAFEETTFLSLSREARGFLIKVLVQDRL
RPTAEETLEHAWFKATAKGADISTDHLKLFLSRRRWQRSQISYKCHLVLRPIPELLRAPP
ERVWVAVPRRPPPGGLSSSSDSEEEELEELPSVPRPLLPEFSGSRVSLTDIATEDDAPGV
PDTRDSTPMDWQEQGGPPPGDSAPSSQALPSPGPQAPEMAAPRRGELRRGSSAESALPRA
GPREPGRGLQKAASVDLPQRRSPSPGAARLARGGLGEGEYAQRLQALRQRLLRVGPEDGK
VSGLRGPLLESLGGGGRARDPRLARAASSEAAPRHPLPPEARSLQKSSSFSQGEAEPRGR
HRRAGAPLEIPVARLGARRLQESPSLSALSEAQPHSPAKPIPDKLSPTKPASPGPTKQPL
ASSRGSPRPGPPKTAREEQVPKPRPSRTPEPPKAAPPAPETPLTPYAQIIQSLQLPGTPK
IVLGPPPEPTPHEAVFAKVASPGKPGLGVKGLGPPSGEKAVLPSRPTGSNRSLSSIENLD
SEEVFEAKFKKSRQSPLARRLKILSRSQSEERGPFRGSEEEDGMYRPSPAGTPLELVKRP
ERSRSVQDLRGAGGPGEMGLVRRLSLSLSQRLRRTPPSQRHPSWGASRAGDGESSEGGDS
AKGSPVLAVRRKLSATLERLSGRLHRSGSSEESGGRSGGSTPLLGRLRRATSEGESLRRL
GLPHNQLAAQAGTATPSAESLGSEASATSASSGPGEGRTRSRWDRWGLSRSRKDKGSSQP
NLPASVQEDSALGYQYVRSESDFPPVFHIKLKDQVLLEGEAATLLCLPAACPAPHISWTK
DKQSLRSEPSVTIVSCKDGRQLLTIPRAGKRHAGLYECSARNALGSTTSSCTLAVARLPG
KLAPPEVPQKYQDTALVVWKPGDSQAPCTYTLERRVDGESTWHCVSSGITDCYYNVTQLP
PGMTVRFRVACANRAGQGPFSNASEKVFVGKVTDTAILKSTQQEIPITSVPAGTPIPSTP
TSPLSTPAPGSPAAPASPAPATPTPDTSAPAPGLPSILVPASPHSPPSAPSSPSPPTPLN
QVRSPLKAVGPPPPTPPRKHRGLLAARQAELTSPSDQPPPSGSEPLASNTKPPSPSPSED
KPSSSPAPMYMVTSFVSAPAIPEPQGPEPAPSPTKVTVRSLTPAKERVSSPASGSPSSPG
PEGTTLRQGPPQKPYTFLEEKARGRFGVVRACRENATGRSFVAKIVPYAAEGKQRVLQEY
EVLRSLHHERLMSLHEAYITPRYLVLIAESCGNRELLCGLSERFRYSEDDVATYVVQLLQ
GLEYLHDHHVLHLDIKPDNLLLAQDNALKIVDFGSAQPYSPQALQPLGHRTGTLEYMAPE
MVKGEPIGSATDIWGVGVLTYIMLSGRSPFYEPDPRETEARIVGGRFDAFLLYPNTSQSA
ALFLRKVLSVHPWSRPSLQDCLAHPWLQDAYLMKLRRQTLTFTTNRLKEFLGEQKRRRAE
AATRHKVLLRSYPGSP
Download sequence
Identical sequences F7CEU5
ENSMODP00000018951 XP_007501715.1.35504 ENSMODP00000018951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]