SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019050 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019050
Domain Number 1 Region: 500-580
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000141
Family Fibronectin type III 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019050   Gene: ENSMODG00000015250   Transcript: ENSMODT00000019393
Sequence length 583
Comment pep:novel chromosome:BROADO5:8:293939558:294169187:1 gene:ENSMODG00000015250 transcript:ENSMODT00000019393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPASAGLCYFLPCLRRWTVRPHCPAPPCAPRPTKRGGGGGGRMNIAAVFNALLVSILAA
VLWKHVRLREHASTLEEALALGRGAREPSPEAGEFVFFHGNASVMLPSLGPRRFQPALLD
LSSVEDHSAQYFNFVELPAGALRALPRPRFVSEAVLIANRFNPDNLMHVFHDDLLPVFYT
MRQFPGLGPEARLLFMEGRPPGPHFDLYRLLSPHAPLMREHLGGLGRLLCFSQAYVGLSK
ATTWYQYGFVQPQGPKASILVSGVEIRRFAGFVAERLNATAGKGPPRGEGYIVVFSRTVN
RLILNEAELLLALAQEFRMKTVTVSLEDHTFADVVRLVGGASMLVSVHGAQLVTALFLPR
GATVVELFPYAVNPDHYTPYKTLAGLPHMDLHYVAWQNTKQENTVTHPDRPWDQGGIAHL
DRAEQERILKSREVPRHLCCRNPEWLFRIYQDTKVDIPSLLQTIRGAGRARPGPGDPQTP
GGLYPSKVKEARCRASVQGASQARLSVSWQVPWNLKFLKVKDVQYEVWIQEQGENAYMPY
ILNHQNHTFADNIKPFTTYLVWIRCIFGRNLLGPFADVLVCST
Download sequence
Identical sequences F6U3Z8
ENSMODP00000019050 ENSMODP00000019050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]