SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019052 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000019052
Domain Number - Region: 24-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00018
Family V set domains (antibody variable domain-like) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019052   Gene: ENSMODG00000015252   Transcript: ENSMODT00000019396
Sequence length 245
Comment pep:novel chromosome:BROADO5:2:267891876:267893686:1 gene:ENSMODG00000015252 transcript:ENSMODT00000019396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILVLGLLLLLSGTGGNLGVLLEGRPGDRVTLSCTGVSSATRWAWAPSFPACVGLLRGRR
PVFWASSSGTPTPASTSPFAGRLRTMDPKGIQQLELLLARGDSGTFYCTGIGGRRVFESR
TSLKVFGDSTACGPTVPTSGSSYTLLLYAMLGVGLTLGLVGLGMAWRLRHPSPQSSALPP
SPPTKTPPVNTETQSLSKEEPRERGESDVERNLLYADLDHIPLRNPRWLRTTVPKETATI
YAVVV
Download sequence
Identical sequences F6U3X4
ENSMODP00000019052 13616.ENSMODP00000019052 ENSMODP00000019052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]