SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019067 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019067
Domain Number 1 Region: 25-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000355
Family V set domains (antibody variable domain-like) 0.042
Further Details:      
 
Domain Number 2 Region: 271-362
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000206
Family Snake venom toxins 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019067   Gene: ENSMODG00000015265   Transcript: ENSMODT00000019411
Sequence length 388
Comment pep:novel chromosome:BROADO5:2:267876281:267886839:1 gene:ENSMODG00000015265 transcript:ENSMODT00000019411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLFPLLGLISKIPSSYTDNILSSYVALRETVELSCPEPPTLYGDEMLSWFRSPVSGSPTI
PVIRVPVTNRGPEARKILKEVRLSLLGNNSLWLEGAKEEDAGRYWCAVLGNYAQYQNWRV
YDLSVIKGSQLSAKTTDGSLCSILVCSVVSARFLDSVIWLEGKGKVKGKVETFKGKDASL
LMVCPLEGPSESRMRRARSIRCIFPQNKGISFNLTASPDSLPAHCVVSPTWDIQKILLLL
CVLGQGVAILALGIVLWRPHLFPVFGSGNRMRCYDCSPDGPCSETIRMCWEGERCGFLEQ
RLHQEKEQIKFPGNPTVTLVHHRPTCVAVHRCEQEQIELVGGVPYTSHSSCCLGDLCNGA
AATMVPSMALSTLVVSTLAWILPGLWGG
Download sequence
Identical sequences F6U345
13616.ENSMODP00000019067 ENSMODP00000019067 ENSMODP00000019067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]