SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019167 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019167
Domain Number 1 Region: 41-153
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000814
Family V set domains (antibody variable domain-like) 0.031
Further Details:      
 
Domain Number 2 Region: 130-240
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000881
Family C1 set domains (antibody constant domain-like) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019167   Gene: ENSMODG00000015349   Transcript: ENSMODT00000019512
Sequence length 295
Comment pep:novel chromosome:BROADO5:6:167163886:167221527:1 gene:ENSMODG00000015349 transcript:ENSMODT00000019512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLLLFRGGGLLDSDTHRNKMHFFLSFMIVGMKLRLITGLFTVTVPKELYMADYGSNVTM
ECNFDTGGQVDIEKLRVSWTKDKKKIVNFPNKQEDPEIHSEHSGRRMTLIEDQLYLRKAL
LHIKDVQIMDAGQYHCLIFYGDAGDYKYVTLQVTASYQIINTQVIKVPGSNEMELTCWSK
GYPLAVVSWANISVPVNTNHSLTPEGLYNITSILRLKTNTHRNFSCEFWNQATQEMTTAI
LDTNVLDQKDKPSIKSSQTYVFIFICIIISIFIAALIFLVRWLCPKVFHRKGLSL
Download sequence
Identical sequences F6WY92
XP_007499609.1.35504 ENSMODP00000019167 ENSMODP00000019167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]