SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019168 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019168
Domain Number 1 Region: 273-359
Classification Level Classification E-value
Superfamily Immunoglobulin 1.1e-18
Family I set domains 0.016
Further Details:      
 
Domain Number 2 Region: 91-167
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000184
Family I set domains 0.041
Further Details:      
 
Domain Number 3 Region: 173-265
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000242
Family C1 set domains (antibody constant domain-like) 0.074
Further Details:      
 
Domain Number 4 Region: 3-75
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000813
Family V set domains (antibody variable domain-like) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019168   Gene: ENSMODG00000015350   Transcript: ENSMODT00000019513
Sequence length 495
Comment pep:novel chromosome:BROADO5:3:506443117:506465484:-1 gene:ENSMODG00000015350 transcript:ENSMODT00000019513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLVNWYRNEPEATFLLSSNITLRPESRYSLVNATSLHITGLVPQDAGNYTCWEVLNKTLG
DHLEHRIQLLVASDPNQINVNISPTGIHPNGSLFVVRGSQVTFNCSSSSHPPHTVEWFFQ
PPGASNESFGPNNETVSYFVLHNISPTYQGNYTCVAKNMLSKRVHRVTSEILVYYPPQSA
LQCRAETAPGGFMLQLICQWSGGYPDPVFLWTEEPGGLILGNSSLGVEKLNQSQLSDGQK
FKCVGNHIVEPGMMGASCTVQITGPMLHSEPMKTCFLGGNVTLSCEVSGANPPAKISWLR
NLTQPGEEILPSSRYLITHEGPVSTLTILNCSQGVDEGYYVCRAENLVRTRELDIWLTVK
KPLNIGGIVGALVILLLLVMGIISGSVLYYKSKNFFLKEQLRTLCISQVVLGGSRIKSTQ
RLGREQRQPFDSVFHLGFRGQDTGDVMITRHGHVHRVTALVNGDVERMGNGLQALQDDSR
ETESDIFQEECDRPV
Download sequence
Identical sequences F6WY84
13616.ENSMODP00000019168 ENSMODP00000019168 ENSMODP00000019168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]