SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019170 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019170
Domain Number 1 Region: 20-131
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000103
Family V set domains (antibody variable domain-like) 0.041
Further Details:      
 
Domain Number 2 Region: 134-220
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000194
Family C2 set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019170   Gene: ENSMODG00000015352   Transcript: ENSMODT00000019515
Sequence length 266
Comment pep:novel chromosome:BROADO5:6:167082640:167119085:1 gene:ENSMODG00000015352 transcript:ENSMODT00000019515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTLLVLVLIISWHLLNAFSVSVPKENYIAHYGSNVTMECNFPVGEKLDWSALMVYWDKK
ENFLVKLVNGEEDLKIQTSNPRIRHLNNKLVKGKSLLHITKVKIEDAGIYRCLIGYGGAD
YKRITLTVNAPYSKINQRVKEDPDTSEHEITCQSEGYPKAEVIWKSKDQDLSSKATVKYA
VGQEKLFNVTSTLRINATANEVFQCLFQVKETGENTTAEIVIPEKKKPSEVKRRAYFGII
GAVIFIGIILMFLCSGKRNAINMEKV
Download sequence
Identical sequences F6WXN8
ENSMODP00000019170 ENSMODP00000019170 XP_007499605.1.35504 XP_007499606.1.35504 XP_007499607.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]