SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019307 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019307
Domain Number 1 Region: 185-295
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000288
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 2 Region: 84-197
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000757
Family Fibronectin type III 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019307   Gene: ENSMODG00000015469   Transcript: ENSMODT00000019655
Sequence length 608
Comment pep:novel chromosome:BROADO5:6:160472912:160518370:-1 gene:ENSMODG00000015469 transcript:ENSMODT00000019655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSQPSGSQRLRLQRGISFSSQALFKQQQPTARGRNPHGWRSSQTCSFREGTNRLSFGV
SMYPGQLGWTISFLLILHFTFGYEDLACYTDYIQTLTCILQVEPGGHAETSPDLTIEWTD
AYGELEEFVTSCSFYRSTHNHTHMQYTCHMDVYKFMSDDEFNVTITDKASNSSSKGRPFI
LSQSIKPYPPFNVTVTYFGDYNISWKTLYEDPLYYALQNKLQYELRYKKLQDSWTVRSFP
ERMFISADLKSALLLSLEFQKDSVYEIQVRARPQSPLYSGIWSEWSNSTFFRTQPVEEKS
EWSSWLFPISLLVAIFASLAGWKLTQRLWKKMWVLVPNPASFFQPLYSAHEGNFKSWVGT
SYVTSTMDLFYWRPMHPEVYESCLTKEIELIDAHGQPKIGYCGILPPGPSQTEVGPFALG
FGERNDKSYGHVSLDTVMVVGDKESGQLCCDCSHLAQDRGGDCDGDNYPKINLDGDQLVG
QGSGDLPLGRDDRIISSGHVSMESPGRIPVWPETPIGSILEALCLHPSEAWDPVSPISLP
SQEGEEKEAFGHPLVSLDMDTFDSGFAGSDCDSPLESDFMGGSPDDTPRSYIKQWVIFPP
SSPGGNLP
Download sequence
Identical sequences F6WWU1
ENSMODP00000019307 ENSMODP00000019307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]