SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019472 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019472
Domain Number 1 Region: 1425-1508
Classification Level Classification E-value
Superfamily SH3-domain 4.99e-21
Family SH3-domain 0.00034
Further Details:      
 
Domain Number 2 Region: 306-383
Classification Level Classification E-value
Superfamily SH3-domain 1.17e-19
Family SH3-domain 0.00000498
Further Details:      
 
Domain Number 3 Region: 1299-1379
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000184
Family SH3-domain 0.0009
Further Details:      
 
Domain Number 4 Region: 625-737
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000279
Family Fibronectin type III 0.00000138
Further Details:      
 
Domain Number 5 Region: 445-603
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000571
Family Fibronectin type III 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019472   Gene: ENSMODG00000015603   Transcript: ENSMODT00000019821
Sequence length 1584
Comment pep:novel chromosome:BROADO5:3:469486287:469846134:1 gene:ENSMODG00000015603 transcript:ENSMODT00000019821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLFFFPPQFRNDLYLQPTVAQKAFGQFLLLEERPRTSPAHVPVLNPDSHHWSLAEHELK
DAAQGKSRLRLQYANLSHKALQYEQVKADYDRLSHILTIVTKERDLALKEKYQLQAKLEN
LEQVLKHMREAAERRQQLELEHEQALAVLNAKQREIELLQKAQVEAKKEHEGAVQLLESK
VRELEEKCRTQSEQFNLLSRELEKFRQQAGKIDLLSGNSVVSLDIPASPNKPFTHFMNGI
AASFGKGQDSPSGSHSVIAEFIRPRPLSSDKPEPLSVKPTFLSRSRSGSPGCRFESDMDN
ERNSNTSKQKYSGKVHLCVARYSYNPFDGPNENPEAELPLTAGKYLYVYGDMDEDGFYEG
ELLDGQRGLVPSNFVDFVQDNESRLSNTLGSEQDQNFINHSGVGLEGESILDLNSPTQGD
SSIINNGAGTLDVNIDEIGEDIVPYPRRITLIKQLAKSVIVGWDPPAVPPGWGTVISYNV
LVDNETRMNLTLGSRTKALIEKLNIAACTYRISVQSITNRGNSDVLQCTLLVGKDVIVAP
SHLRVDHITQISAELSWLPTNSNYSHVIFLNEEEFDIVKAARYKYQFFNLKPNMAYKVKV
LAKPHQMPWQLPLEQREKKEAFVEFSTLPAGPPAPPQDVTIQAGTTPATIQVSWKPPTLT
PTGMSNGANVSGYGVYAKGQRVAEVIFPTADSTTVELMRIRNLEAKEVTVRTLSTQGESM
DSLIAAIPPDLLVPPTPHPRTTPKPKPLASAGAPDTKDEQLGPHIKMDESWEQTRSAAPT
HGHMLEPPTSNFPGSAPGRRSPSPNRILPQPQGTPVPNTVAKAMAREAAQRMAESSRLEK
RSLFEDRSRAGHYANSDEEEEDGYDSPDIKRRGASVDDFLKGSELGKQSHYGHGEEYHTE
SSRGSDLSDIMEEDEEELYSEMQLEDGGRRRSSGTPHNTLKECCDNRTTTDATFWEQPEF
PQQTHHSKKLFSIPEVAEEDGDYSELLHKQGLGLSYKMKAPGPRGPRYPRCCIEDKAQHA
TWFPTKHRLSGFAHHSEDSAPEDKGCRFSRSLTRSPDSGLDCGSEEEESRFSFRNVHGHM
SPHAGPPCCQGRSPCSCWRSPRPLLARRKTLTRQTSIEEDFGEQFAPSEVIRSNESTPGP
ERTSPRKSYFSEPIKSEDPCCAWKVKMSDSRAAVPLTKSTPRDGEGSLLLGNPASAGRTD
RVDHTGRRLSHGSAGPQRPRPMMVPSIEITMDSNSEGGRSRSGSEGNIPSVKEEAYSRGM
GGHRIRPLHRAMTPDLRHDGYCSRDRLSPDLYEESETDPGTEDLSVRIFVALFDYDPHTM
SPNPDGAEEELPFKEGQIIKVYGDKDADGFYRGETCARLGLIPCNMVSEIQADDEEMMDQ
LLKQGFLPLNTPVEKIVNCDRFKESALSVHRRSRKSKRERNRRSGRQHPVSTRRMVALYD
YDPRESSPNVDVEAELTFCTGDIITVFGEIDEDGFYYGELNGQKGLVPSNFLEEVPDDVE
VYLSDTPSRYSQDAPMRTKAKRVPPENTGTSRRAPSPTVHLHSGSPPSTMGSGSPGRGRE
RASKKKKGLLSKGKKLLRKLGAVK
Download sequence
Identical sequences F6Z5M6
ENSMODP00000019472 ENSMODP00000019472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]