SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019479 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019479
Domain Number 1 Region: 1454-1628
Classification Level Classification E-value
Superfamily Fibronectin type III 2.78e-29
Family Fibronectin type III 0.0000548
Further Details:      
 
Domain Number 2 Region: 914-1089
Classification Level Classification E-value
Superfamily Fibronectin type III 4.09e-25
Family Fibronectin type III 0.00057
Further Details:      
 
Domain Number 3 Region: 1820-1987
Classification Level Classification E-value
Superfamily Fibronectin type III 5.88e-24
Family Fibronectin type III 0.0000122
Further Details:      
 
Domain Number 4 Region: 1274-1443
Classification Level Classification E-value
Superfamily Fibronectin type III 1.99e-23
Family Fibronectin type III 0.0000193
Further Details:      
 
Domain Number 5 Region: 722-896
Classification Level Classification E-value
Superfamily Fibronectin type III 2.95e-21
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 6 Region: 353-408
Classification Level Classification E-value
Superfamily Kringle-like 4.85e-21
Family Fibronectin type II module 0.0000607
Further Details:      
 
Domain Number 7 Region: 413-468
Classification Level Classification E-value
Superfamily Kringle-like 1.08e-20
Family Fibronectin type II module 0.0000597
Further Details:      
 
Domain Number 8 Region: 1639-1810
Classification Level Classification E-value
Superfamily Fibronectin type III 1.68e-20
Family Fibronectin type III 0.00093
Further Details:      
 
Domain Number 9 Region: 1178-1266
Classification Level Classification E-value
Superfamily Fibronectin type III 3.35e-17
Family Fibronectin type III 0.00000651
Further Details:      
 
Domain Number 10 Region: 2134-2177
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000157
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 11 Region: 520-564
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000262
Family Fibronectin type I module 0.0047
Further Details:      
 
Domain Number 12 Region: 562-608
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000404
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 13 Region: 624-705
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000077
Family Fibronectin type III 0.00000503
Further Details:      
 
Domain Number 14 Region: 235-279
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000012
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 15 Region: 472-513
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000144
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 16 Region: 2089-2132
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000222
Family Fibronectin type I module 0.0039
Further Details:      
 
Domain Number 17 Region: 98-143
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000236
Family Fibronectin type I module 0.00011
Further Details:      
 
Domain Number 18 Region: 188-234
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000484
Family Fibronectin type I module 0.00019
Further Details:      
 
Domain Number 19 Region: 54-95
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000314
Family Fibronectin type I module 0.0002
Further Details:      
 
Domain Number 20 Region: 146-186
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000366
Family Fibronectin type I module 0.00017
Further Details:      
 
Domain Number 21 Region: 2177-2218
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000249
Family Fibronectin type I module 0.0028
Further Details:      
 
Domain Number 22 Region: 311-349
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000222
Family Fibronectin type I module 0.00032
Further Details:      
 
Domain Number 23 Region: 2004-2066
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000109
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 24 Region: 1100-1185
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000713
Family Fibronectin type III 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019479   Gene: ENSMODG00000015605   Transcript: ENSMODT00000019828
Sequence length 2275
Comment pep:novel chromosome:BROADO5:7:178092901:178180591:1 gene:ENSMODG00000015605 transcript:ENSMODT00000019828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGDPVPGRRRLLLLLLLALCLGASVQGAKTTKKRRQTQQMIQPPSPVAVSQSKTGCYDN
GKHYQINQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERP
KDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKG
EWTCKPVAERCYDNTAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQD
TKTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHSSLQTTATGPGTFTDVQTALYQ
PQPQPQPVPYGHCVTDSGVVYSLGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNS
NGEPCVLPFTYNGRTYYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNS
NGALCHFPFLYNNRNYTDCTSEGRRDNMKWCGTTLNYDADQKFGFCPMAAHEEICTTNEG
VMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCVAYSQLRDQCIVDGITYNVNDTFHKRH
EEGHMLNCTCFGQGRGRWKCDPIDQCQDSETRTFYQIGDSWEKYVHAVRYQCYCYGRGIG
EWHCQPLQTYPGTSGPVQVIITESPNQPNSHPIQWNAPEPSHISKYILRWKPKNSPGRWK
EATIPGHLNSYTIKGLRPGVIYEGQLISVQHYGHKEVTRFDFTTTSTGPPVSTNMVTGET
TPPPPVVTTSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSV
NIPDLLPGRKYIVNVYQISEEGEQNLILSTSQTTAPDAPPDHAVDRVDDTSIVIRWSRPQ
APITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGMQYNITIYAVEENQESTPVFIQ
QETTGVHRQDNVPPPTDLQFVEVTDVKVTIMWRPPESAVTGYRVDVVPVNLPGEHGQRLP
VSRNTFAEISGLSPGVTYYFKVFAVNQGKESKPLTAEQTTKLDAPTNLRFVNETDTTVLV
TWTPPRARIAGYRLTVNPTRGNQPKQYNVGPSATQYPLRNLQPGSEYTASLVAVKGNQQS
PKQTGVFTTLQPASSIPHYNTEVTETTIIITWIPAPRIGFKLGVRPSQGGEAPREVTSES
GSIVVSGLTPGVEYVYSISVLRDGQERDSPIVKKVVTPLSPPANLHLEANPDTGILTVSW
EKSTTPDITKYRITTTPTSGQEGYTLEEVVNPDQNSCTFENLSPGVEYNVSVYTVKGDQE
SVPISDTIIPAVPPPTDLRFTNVGPDTMRVTWAPPSSIELTNFLVRYSPVKNEEDVAELS
ISPSDNMVVLTNLLPGTEYLVSVSSVYEQHESIPLKGIQKSGLDSPTGIDFSDITANSFT
VHWMSPRAPNTGYRIRHHPEHGVGRPREDRVPPSRNSITLTNLNPGTEYVVSIISVNGRD
ESAPLVGQQSTVSDVPRDLEVIATTPTSLLISWDAPAVTVRYYRITYGETGGSSPVQEFT
VPGTKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPVTIAYRTEIDKPSQMQVTDVQD
NSISVRWLPSSSPVTGYRVTTAPKNGSGPSKTKTTGPDQTEMTIEGLQPTVEYVVSVYAQ
NQNGESQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHE
LFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPSPTNLKFSQVSP
TSLTAQWVAPNVQLTGYRVRVTPKEKTGPMKEINLSPDSTSVVVSGLMVATKYEVSVYAL
KDTLTSRPAQGVVTTLENVSPPRRARVTDATETTITINWRTKTETITGFQVDAIPSNGQS
PIQRTISPEVRSYTITGLQPGTDYKIHLYTLNDNARSSPVIIDASTAIDAPSNLRFLTTT
PNSLLASWQPPRARITGYIIKYEKPGLPPREVVPRPRPGVTEATITGLEPGTEYIIYVIA
LKNNQKSEPLIGRKKTGQEALSQTTISWTPFQESSEYIISCHPIGIDEEPLQFRVPGTSA
SATLTGLTRGATYNIIVEALKNQRRHKVREEMVTVGNSVNEELNQPTDDTCFDPFTVTHY
SIGEEWERLSDSGFKLWCQCLGFGSGHFRCDSSKWCHDNGVNYKIGDKWDRQGENGQMMS
CTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQQGWRCDNCRR
PGVETAPEGSAGHSYTQFSQRYHQRTNTNVNCPIECFMPLDVQADTENSRDSLEK
Download sequence
Identical sequences F6Z5G8
XP_007501843.1.35504 ENSMODP00000019479 ENSMODP00000019479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]