SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019482 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019482
Domain Number 1 Region: 284-528
Classification Level Classification E-value
Superfamily SIS domain 0.00000000000000512
Family mono-SIS domain 0.017
Further Details:      
 
Domain Number 2 Region: 29-185
Classification Level Classification E-value
Superfamily SIS domain 0.0000393
Family mono-SIS domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019482   Gene: ENSMODG00000015608   Transcript: ENSMODT00000019831
Sequence length 625
Comment pep:novel chromosome:BROADO5:1:508848619:508873322:1 gene:ENSMODG00000015608 transcript:ENSMODT00000019831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTKRFQHVIETPEPGKWELSEYEASLPITEKSNPLTKDLDKANAEQIVQLLGQCDAEI
FQEEGSAMPAYQRWFLYLPIKERIFIFSLKTDLGNSYGYDPEGGLVVLSGGGTSGRMAFL
MSVSFNQLMKGLGQKPLYTYLIAGGDRSVVASREGTEDSALHGIEELKKVAAGKKRVIVI
GISVGLSAPFVAGQMDFCMSNPDIFLPVLVGFNPINMARNDPIEDWNSTFREIAEKMQKL
QEKQKAFVLNPAIGPEGLSGSSRMKGGSATKVLLETLLLAAHKTVDRGIAASQSCLLEIL
RTFERAHKVTYSQGTKIAALMKQASTRLLSKGRVYLVGWQTLGIIAIMDGLTFKTYFQDV
RGFLIGDHSDMFNRKEELIDQGPQFSFSQEDFLSSILPSLTEIDTVLFIFTLDDNLTEVE
TLVEQVKKKTPNIQALAHSTVGQYLPSPLKKLFPSIISITWPLLFFEYEGNFIQKFQREL
STKWVLNTVSTGAHVLRGKILYNHMLDLRLRNSKLFWRGLAMLQRFSGQPKAQCIKSLLK
AIHFPQEVSEEIQAAPISYHIQVAHEKEQVIPTALLTLLFRCSIPEAKTHLTASPSVCET
IKNILLRLGRKRSADSIDTLKMTIE
Download sequence
Identical sequences F6Z539
13616.ENSMODP00000019483 ENSMODP00000019482 ENSMODP00000019483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]