SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019484 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019484
Domain Number 1 Region: 2-96
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000053
Family Fibronectin type III 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019484   Gene: ENSMODG00000015610   Transcript: ENSMODT00000019833
Sequence length 186
Comment pep:novel chromosome:BROADO5:1:508830522:508832605:-1 gene:ENSMODG00000015610 transcript:ENSMODT00000019833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDRPPSPVNVTITQLIANSATVSWDVPEAHCHCYASPSKQNGPGQRVIREVNTTTRACAL
WGLAEDSDYTIQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSDITVKGLDGERTLQT
GEVVIIVVVLIMWAAVIGLFCRQYDIIKDNDSNNPKEKGKGPEQSPQGRPMGARQKKSPS
INTIDV
Download sequence
Identical sequences F6Z530
13616.ENSMODP00000019484 ENSMODP00000019484 ENSMODP00000019484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]