SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019595 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019595
Domain Number 1 Region: 499-699
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.54e-23
Family SPRY domain 0.0059
Further Details:      
 
Domain Number 2 Region: 192-255
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.44e-16
Family B-box zinc-binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 420-501
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000361
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 4 Region: 6-45,100-135
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000505
Family RING finger domain, C3HC4 0.028
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000019595
Domain Number - Region: 137-187
Classification Level Classification E-value
Superfamily RING/U-box 0.0424
Family ZZ domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019595   Gene: ENSMODG00000015705   Transcript: ENSMODT00000019944
Sequence length 718
Comment pep:novel chromosome:BROADO5:3:55901367:55966842:-1 gene:ENSMODG00000015705 transcript:ENSMODT00000019944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKATIKNIERELICPACKELFTHPLILPCQHSICHKCVKEILLLTFDDSFNDVASESSCQ
SSPRLRVQSPSMDKIDRINRAGLINYSGWKRNSLTPRTTTFPCPGCEHDIDLGERGINGL
FRNFTLETIVERYRQAARAATAIMCDLCKPPPQESTKSCMDCSASYCNECFKIYHPWGTV
KAQHEYVGPTTNFRPKILMCPEHEMERVNMYCELCRRPVCHLCKLGGNHSNHRVTTISSA
YKTLKEKLSKDIDYLIGKESQVRSQISELNLLMKETECNGERAKEEAASHFNKLFEVLEE
KKTSIIKAIDVSKKLRLDKFQAQMEEYQGLLENNGLVGYAQEVLKETDQSCFVQTAKQLH
LRIQKATESLKTFRPAAQTSFEDYVVDASKQEELLGELAFFSNGVDIPEINEEQSKIYNN
ALICWHHSEKKNKADSYILEYRKISREEEMLTWSETEVYSTSKVISDLESNSSYAFRVRG
YKGSVCSPCSREVILHTPPASVFSFLFDEKCGYNNEHLLLNLKRDRVDSRAGFSLLLAAE
RVHVGCYTSLDYIIGDTGITKGKHFWALRVEPYSYMVKVGVASNDKLQEWLHNPRDISSP
RYEQDSGHDSGSEDTCFDSSQPFTLVTVGMKKFFVPKSPTSSNEPENRVLPMPACIGIFL
DYDKGKVGFYDADHMKCLYERQVDCSGTMYPAFALMGSGGIQLEEPITAKYLEYQDNL
Download sequence
Identical sequences F7DGH4
ENSMODP00000019595 ENSMODP00000019595 XP_016286850.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]