SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019728 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019728
Domain Number 1 Region: 36-215
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 9.62e-36
Family MHC antigen-recognition domain 0.0000601
Further Details:      
 
Domain Number 2 Region: 219-311
Classification Level Classification E-value
Superfamily Immunoglobulin 2.07e-23
Family C1 set domains (antibody constant domain-like) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019728   Gene: ENSMODG00000015810   Transcript: ENSMODT00000020082
Sequence length 357
Comment pep:novel chromosome:BROADO5:2:267432261:267439029:-1 gene:ENSMODG00000015810 transcript:ENSMODT00000020082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVIRVPRPLAAAQLGLLLLLQLLQPAQTAAAGTSSHYLRYDFAIVSQPSQGQSSYTVLG
YLDGQPFVWCCRQGQRAEPRAPWSQVQGPRSWERLIRSLKTVAQRLVIDLKSMMGTKETE
KVWNGEAPGSHTLQALAMCEFQGNQSNPGFWRYGYDGQELILDLEMLNLTETESKRQEEI
RKYQRRANLEQDFLVRTCLHPLRKYLEAGVLTLQKTVPPSVRVTHHGTFSKKSTLKCQAF
SFYPPDISLTWLQDGKPTIKGTQESQSVRPQGDGTYQSYVNVEVPSEEESRYACLVEHQA
LNGTFTGIWEPPPPKLPPIWILSGCLASALVFVGTTIVFIWRRWKRKRTGFRTKENV
Download sequence
Identical sequences F7FE89
ENSMODP00000019728 ENSMODP00000019728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]