SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019842 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019842
Domain Number 1 Region: 23-69
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000262
Family Elafin-like 0.0018
Further Details:      
 
Domain Number 2 Region: 75-171
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000406
Family Fibronectin type III 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019842   Gene: ENSMODG00000015901   Transcript: ENSMODT00000020197
Sequence length 179
Comment pep:novel chromosome:BROADO5:7:250694804:250698445:1 gene:ENSMODG00000015901 transcript:ENSMODT00000020197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CVLPQTQHECLTSCEFLKTLQTVKQGDCPPAARASGFAAACVQSCEGDRECPGNRKCCFN
ACGHTCQIPDNINRGVPLRPRKSLTILERSGGTVQVSWKSKSSISIEPVFYVLQSRWHWG
LHPSEDDATEWKAMALTMEESAHLDSIGPNRWYQFRVAAVNAHGTRGFTPPSKHFQSSR
Download sequence
Identical sequences F7AFW5
ENSMODP00000019842 13616.ENSMODP00000019842 ENSMODP00000019842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]