SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019945 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019945
Domain Number 1 Region: 38-385
Classification Level Classification E-value
Superfamily L domain-like 3.66e-54
Family Ngr ectodomain-like 0.0039
Further Details:      
 
Domain Number 2 Region: 429-516
Classification Level Classification E-value
Superfamily Immunoglobulin 5.75e-18
Family I set domains 0.02
Further Details:      
 
Domain Number 3 Region: 529-596
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000109
Family Fibronectin type III 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019945   Gene: ENSMODG00000015980   Transcript: ENSMODT00000020302
Sequence length 713
Comment pep:novel chromosome:BROADO5:8:164740789:164743176:1 gene:ENSMODG00000015980 transcript:ENSMODT00000020302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAKMKDMPLKIQVLLGLALTALVQGIDKKVDCPPSCTCEIRPWFTPRSIYMEALTVDCND
LGLFNFPDRLPADTQILLLQTNNIAKIENTVNFPVNLTGLDLSQNNLFSVTNINVRKMPQ
LLSIYLEENKLTELPEKCLSRLNNLQELYINHNLLSTISPGAFIGLHNLLRLHLNSNKLQ
MINSKWFEAIPNLEILMIGENPIIRIKDMNFKPLINLRSLVIASINLTEIPDNALVGLDN
LESISFYDNRFVKVPHEALQKVINLKFLDLNKNPINRIRRGDFSNMLHLKELGINNMPEL
ISIDSLAIDNLPDLRKIEATNNPRLSYIHPNAFYRLPKLESLMLNSNALSALYHGTVESL
PNLKEISIHSNPIRCDCVIRWINMNKTNIRLMEPDSLLCVDPPEFQGQNVRQIHFREMME
ICLPLIAPESFPSNLDLEAGSYVSLHCRATAEPEPEIYWITPSGHKLLPNTLSEKFYVHS
EGTLEISDITPKDGGLYTCIATNLVGADLKSIMIKVDGSFPQDNNGSLNIKIKDIQSNSV
LVSWKANSKILKSSVKWTAFVKTENSYAAQSARIPSDVKVYNLTHLNPSTEYKICIDIPT
IYQQNKKQCINVTTKGLDLDLKGYEKNNVTAFIACLGGLLGVISVICLFSCISQEMNCDA
GHSYVRNYLQKPTFAFSELYPPLISLWDSRKEKSTALEVKATVIELSFGFSVW
Download sequence
Identical sequences F7EZN3
ENSMODP00000019945 ENSMODP00000019945 13616.ENSMODP00000019945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]