SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020024 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020024
Domain Number 1 Region: 840-1041
Classification Level Classification E-value
Superfamily Fibronectin type III 4.5e-37
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 2 Region: 637-825
Classification Level Classification E-value
Superfamily Fibronectin type III 5.32e-32
Family Fibronectin type III 0.00000776
Further Details:      
 
Domain Number 3 Region: 349-451
Classification Level Classification E-value
Superfamily Immunoglobulin 3.34e-19
Family I set domains 0.018
Further Details:      
 
Domain Number 4 Region: 284-365
Classification Level Classification E-value
Superfamily Immunoglobulin 3.37e-18
Family I set domains 0.015
Further Details:      
 
Domain Number 5 Region: 537-634
Classification Level Classification E-value
Superfamily Immunoglobulin 3.73e-18
Family I set domains 0.014
Further Details:      
 
Domain Number 6 Region: 450-550
Classification Level Classification E-value
Superfamily Immunoglobulin 6.45e-16
Family I set domains 0.026
Further Details:      
 
Domain Number 7 Region: 42-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000271
Family I set domains 0.0091
Further Details:      
 
Domain Number 8 Region: 147-228
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000646
Family I set domains 0.035
Further Details:      
 
Domain Number 9 Region: 1078-1172
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000502
Family Fibronectin type III 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020024   Gene: ENSMODG00000016040   Transcript: ENSMODT00000020381
Sequence length 1322
Comment pep:novel chromosome:BROADO5:8:160115137:160341535:-1 gene:ENSMODG00000016040 transcript:ENSMODT00000020381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLKIMPQKKSLSVLQTPLILFLCQVMSALEVPLDQLENLVQPPTITRQSPKDYIIDPRE
NIEIQCEAKGKPPPSFSWTRNGTHFDIDKDPLVKMLPNSGTLVISITIEGKAETYEGVYQ
CTARNERGAAISNNIVIRPSRSPLWTKEKLEQITILKGQSLVLPCRPPLGLPPPIIFWMD
NSFQRLPQSERVSQGLNGDLYFSNVLPEDTREDYICYARFNHTQTIQQKQPISVKVHSMD
ELNDTITANLSDSEFYGAKSYIERPPKLLTPEGRTSHKEELRENVLSLECIAEGLPTPSI
NWTKEDGELPINRTFYKNFKKTLNIIHVSEADSGKYKCTARNSLGFVEHTISVTVKAAPY
WITAPRNLVLSPGEDGTLICRANGNPKPNISWLINGVPIEMAPDDPSRKIDGDTILFSDV
QESSSAVYQCNASNEYGYLLANAFVNVLAEPPRILTEVDLRYQVITDRPAMLDCAFFGSP
IPTIEWFKGTKGSVLQENTYVFHDNGTLEIPVAQKDSADTYTCVVRNKLGMAKNDVHLEV
KDPTRIIKQPEYKIVQRGGRVSFECTVKHDPTLIATLTWLKDYGELPNDGRFSIDNDHLV
IMNISDEDDATYTCVANTSLDIVSASAMLRVVAPVYDRPNPPFDLELTSFLERSVQLSWI
PGEENNSPITEFIIEYEDAFHEPGIWHHQTDVPGIQTTAELKLSPYVKYSFRVIAVNSIG
RSLPSEASEYYMTKAAEPEENPTAVEGIGSEPDNLVITWQPLKGFDSNGPGLQYKVSWRQ
KDGDDEWTSVVVANVSKYIVSGTPTFVPYLVKVQALNNVGFAPEPGIIIGHSGEDLPMVA
PSNVRVNVVNSTLAEVHWEPVPPKSIRGHLKGYRIYYWKVKNSSKRNRRHVEKKILTFNG
NKTHGMLPGLEPFSHYTLNVRVVNGKGEGPASVDQVFNTPEGVPGAPLFLKIVNPTLDSL
TLEWDPPSHPNGILTAYTLKFQPINSTHELGPLVDLKIPANMTSLILRNLSYSTRYKFYF
YAQTAAGTGSPITEEAVTTVDEAGVHPPAVGADKGYSEIHFSTSPAMHTSRPTFYKVRPV
IPRIRNVTAAAADTYANISWEYEGPDHVHFYVEYGVAGSKEEWRKDIVNGSRSFFGLKGL
LPGTSYKVRVGAEGDSGFVSSEAVFETGPAMASRQVDIATQGWFIGLMCAVALLILILLI
VCFIRRNKGGKYPVKEKEDAHADPEIQPMKEDDGTFGEYRSLESDAEDHKPLKKGSRTPS
DRTVKKEDSDDSLVDYGEGVNGQFNEDGSFIGQYSGKKEKEPAEGNESSEAPSPVNAMNS
FV
Download sequence
Identical sequences F6YUK5
ENSMODP00000020024 ENSMODP00000020024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]