SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020045 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020045
Domain Number 1 Region: 32-498
Classification Level Classification E-value
Superfamily Sema domain 6.02e-168
Family Sema domain 0.00000000104
Further Details:      
 
Domain Number 2 Region: 500-548
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000222
Family Plexin repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 558-631
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000398
Family I set domains 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020045   Gene: ENSMODG00000016056   Transcript: ENSMODT00000020402
Sequence length 832
Comment pep:novel chromosome:BROADO5:1:503042095:503057652:1 gene:ENSMODG00000016056 transcript:ENSMODT00000020402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPCLGIWLVASALLGLGNGDNAWWNLVPRKTVSYGELAAVVKRFSQVGIQDFLTLTLAE
SNGVLYVGAREALFALSLETLELQSSITWEATVEKKAECIQKGKSNQTECFNFIRFLQPY
NSSHLYTCGTYAFQPKCTYIDVLTFSLEHGELEDGKGKCPYDPAKGHTGLIVDGELYSAT
LNNFLGTEPVILRNLGPHYSMKNEYLYSWLNEPHFVGSAYVPESVGSLTGDDDKIYFFFS
ERAVEYNCYAEQVVARVARVCKGDMGGARTLQKKWTTFLKARLVCAAPDRQLYFNQLQAL
HTLQEDGWPNTTFFGVFRARWGDVDLSAVCQYQLEDIQRVFEGPYKEYQQQAQKWGPYTD
PVPSPRPGSCINNWHRRHGYTSSLELPDNTLNFAKKHPLMEGQVGPRWGRPLLVKKDTNF
THLVADQVKGLDDVTYDVLFIGTGDGWLYKAVNLGAWVHVIEELQVFDKEPVESLVLSYN
KKLLFAGSRSQLAQLPLADCSKYRSCADCILSRDPYCAWSTNTSRCMPLLGHLKSLFIQD
VVNSNTGLCNLRPSKKVKITPKNITVVAGTDLVLPCRLSSNLAHARWTFGGRELPAEQPG
SLLYDARLQALVVLAAQPRHAGAYHCFSEEQGARLAAEGYLVAVVAGPSVTLETRAPLEN
LGLVWLAVVALGALCLVLLLLVLSLRRRLREELEKGAKAAERTLVYPLELPKEPTSPPFR
PGTDTDEKLWDPVGYYYSDGSLKIVPGHARCQPGGGPPSPPPGIPGQPLPSPTRLHLGGG
RNSNANGYVRLQLGGDDRAGPMHPLPELADELRRKLQQRQPLPDSNPEESSV
Download sequence
Identical sequences F7GIY2
ENSMODP00000020045 ENSMODP00000020045 13616.ENSMODP00000020045 XP_007475953.1.35504 XP_007475954.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]