SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020122 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020122
Domain Number 1 Region: 52-160
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000252
Family Fibronectin type III 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020122   Gene: ENSMODG00000016112   Transcript: ENSMODT00000020479
Sequence length 377
Comment pep:novel chromosome:BROADO5:1:48195729:48269760:1 gene:ENSMODG00000016112 transcript:ENSMODT00000020479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVPPRLDPALGSPASPCEDVIKNLSLEAIQLCERDGNKSQDSGIAEMEELPVPHNIKIS
NITCDSFKISWEMDSKSKDRITHYFIDLNKKENKNSNKFKHKDVPTKLVAKAVPLPMTVR
GHWFLSPRTEYTVAVQTASKQVDGDYVVSEWSEIIEFCTADYSKVHLTQLLEKAEVIAGR
MLKFTVFYRNQHKDYFDYIREQHGSAMQPSVKDNSGSHGSPISGKLEGIFFSCSTEFNTG
KPPQDSPYGRYRFEVAAERLFNPNTNLYFGDFYCMYTAYHYVILVLAPVGSAGDEFCKQR
LPQLNSKENKFLTCTEEDGALVYHHAQDVILEVIYTDPVPLALGTVAEITGHQLMSLSTA
NAKKDPSCKRVKIRGGG
Download sequence
Identical sequences F7EAV9
ENSMODP00000020122 13616.ENSMODP00000020122 XP_001376020.1.35504 ENSMODP00000020122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]