SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020127 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020127
Domain Number 1 Region: 603-904
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.31e-83
Family Protein kinases, catalytic subunit 0.0000000000886
Further Details:      
 
Domain Number 2 Region: 12-186
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.04e-77
Family Ephrin receptor ligand binding domain 0.0000000142
Further Details:      
 
Domain Number 3 Region: 314-519
Classification Level Classification E-value
Superfamily Fibronectin type III 3.23e-42
Family Fibronectin type III 0.0000251
Further Details:      
 
Domain Number 4 Region: 900-973
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.68e-21
Family SAM (sterile alpha motif) domain 0.0000281
Further Details:      
 
Domain Number 5 Region: 244-314,352-371
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000131
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020127   Gene: ENSMODG00000016114   Transcript: ENSMODT00000020484
Sequence length 975
Comment pep:novel chromosome:BROADO5:4:354855549:355083354:-1 gene:ENSMODG00000016114 transcript:ENSMODT00000020484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLQLLLCALLAETLMDSTTATAELGWIVHPPSGWEEVSGYNENMNTIRTYQVCNVFESSQ
NNWLRTRYIRRRGAQRIHVEMKFSVRDCSSIPNVPGSCKETFNLYYYEADFDSATKTFPN
WMENPWVKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRNGFYLAFQDYGGCMSLIA
VRVFYRKCPRVIQNGAVFQETLSGAESTSLVAARGTCIPNAEEVDVPIKLYCNGDGEWLV
PIGRCMCKAGYESVENGTACRGCPSGPSGHQGDEGCTHCPINSRTTSEGATNCVCRNGYY
RADLDPLEMPCTTIPSAPQAVISSINETSLMLEWTPPRDSGGREDLVYNIICKSCGSGRG
ACTRCGDNVQFAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFSPQFASVNIT
TNQAAPSAVSIVHQVSRTVDSMTLSWSQPDQPNGVILDYELQYYEKDLSEYNATAVKSPT
NTVTVQGLKAGTIYVFQVRARTVAGYGRYSGKMYFQTMTEAEYQTSIQEKLPLIIGSSAA
GLVFLIAVVVIAIVCNRRGFERADSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVR
EFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSE
ASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGI
AAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPI
RWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMD
CPNALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTVP
DYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNS
IQVMRAQMNQIQSVE
Download sequence
Identical sequences F7EAT1
ENSMODP00000020127 ENSMODP00000020127 13616.ENSMODP00000020127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]