SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020258 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020258
Domain Number 1 Region: 52-298
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.99e-84
Family Eukaryotic proteases 0.0000945
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020258   Gene: ENSMODG00000016174   Transcript: ENSMODT00000020615
Sequence length 298
Comment pep:novel chromosome:BROADO5:6:155835269:155841161:-1 gene:ENSMODG00000016174 transcript:ENSMODT00000020615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVPDTLLLRSLHFPGTLGAAGSGKGEAAPGRAQNPGREGGERENAERAPNSTSRESRIVG
GGAAQRGQWPWQVSLRERGQHVCGGSLISRQWVLTAAHCVPSSLNPRDLQIQLGEQILYT
KPRYSILVPVRHIVLHPHYDGDALHGKDMALLKITRPVPFSNFIQPITLAPPGTQVPQKT
LCWVTGWGDIRKNGEIEGMPLPRSYPLQEVDVRIVDTQTCRVLYDPEPIGDAMLCAGQGQ
GRKSFCDGDSGGPLVCQGRNRRWLQVGVVSFTRGCAEPQFPGVYSRVSSFVPWIRQYV
Download sequence
Identical sequences F7G8Q4
ENSMODP00000020214 13616.ENSMODP00000020214 ENSMODP00000020258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]