SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020273 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020273
Domain Number 1 Region: 41-222
Classification Level Classification E-value
Superfamily PR-1-like 7.46e-51
Family PR-1-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020273   Gene: ENSMODG00000016219   Transcript: ENSMODT00000020630
Sequence length 253
Comment pep:novel chromosome:BROADO5:1:500106311:500119851:1 gene:ENSMODG00000016219 transcript:ENSMODT00000020630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLQGPLCLVGLLFWGSQRVAALGLPNNTLELARPGAMPSGLALGASVPRPRRKRHISA
RDMSALLDYHNRLRARVYPPAANMEYMVWDERLARTAEAWAARCIWDHGPPQLMKFLGQN
LSIHSGRYRSVLDLVKSWSEEKQHYSFPNPRECSPHCPWHCSGPVCTHYTQMVWASSSRL
GCALHTCKNISIWGNTWRQAVYLVCNYAIKGNWIGEAPYKMGKPCSACPPSYGGGCNNNM
CFAGLRSNRLIWF
Download sequence
Identical sequences F7FM10
ENSMODP00000020273 13616.ENSMODP00000020273 ENSMODP00000020273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]