SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020290 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020290
Domain Number 1 Region: 101-218
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000299
Family V set domains (antibody variable domain-like) 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020290   Gene: ENSMODG00000016230   Transcript: ENSMODT00000020647
Sequence length 285
Comment pep:novel chromosome:BROADO5:7:192248040:192350169:-1 gene:ENSMODG00000016230 transcript:ENSMODT00000020647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MREREETHSSAGLPHGPESHCLSTATESLRKGVFAKRAVAKVSLSKGSHCHHPLKLPGCN
QAMLLLGSRREMGKLHHPMNWPCTAMLSLLFIPSISKGIHVTQPAVILANSRGVASFVCE
YELTAKTKEIRVSLLRQMDDELVEVCASTYLVQNQPVFMDDMLECTGNVSGDKVMLTLTG
LKALDTGLYFCKVELMYPPPYYVGLGNGTQIYVIDPEPCPDSDVSLWILAIVSSGLFFYS
LLITAVSLNKMLKKRSLLTTGVYVKMPPTEPEHEKQFQPYFITIH
Download sequence
Identical sequences F7FLL7
ENSMODP00000020290 ENSMODP00000020290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]