SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020413 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020413
Domain Number 1 Region: 21-122
Classification Level Classification E-value
Superfamily Immunoglobulin 1.58e-46
Family V set domains (antibody variable domain-like) 0.0000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020413   Gene: ENSMODG00000022737   Transcript: ENSMODT00000020772
Sequence length 145
Comment pep:known chromosome:BROADO5:Un:43298894:43299450:1 gene:ENSMODG00000022737 transcript:ENSMODT00000020772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFELKGIFILMILQGVHCDIPLVESGGDLRQPGGSLKLSCKASGFTFTSYGMNWIRQAP
GKGLEWVSYINGAGSSTSYADSVKGRFTISRDNGNSLLHLQMNSLKAEDTAMYYCARDTV
RESSERADKNLLSREFWWRMTEREL
Download sequence
Identical sequences H9H6T6
ENSMODP00000020413 ENSMODP00000020413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]